Lus10017905 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 163 / 3e-47 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 157 / 2e-46 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 157 / 5e-46 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G27820 155 / 8e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 154 / 9e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 149 / 5e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 148 / 3e-42 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 146 / 8e-42 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 145 / 4e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001651 613 / 0 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 582 / 0 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000561 546 / 0 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 498 / 7e-179 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 429 / 4e-152 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 421 / 1e-148 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10038113 323 / 3e-111 AT3G44240 140 / 3e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017894 255 / 5e-86 AT1G06450 47 / 8e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017895 239 / 3e-79 AT1G06450 98 / 4e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 214 / 1e-67 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 163 / 3e-48 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.001G046700 161 / 2e-47 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 151 / 9e-44 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 149 / 5e-43 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 149 / 2e-42 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 148 / 2e-42 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 147 / 1e-41 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 144 / 6e-41 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 142 / 5e-40 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10017905 pacid=23148788 polypeptide=Lus10017905 locus=Lus10017905.g ID=Lus10017905.BGIv1.0 annot-version=v1.0
ATGGCTATGAGAGAAGTCTGGAACCATAATTTCGACCAAGAACTGCACGCCATGGAAGTCTGTTTGAGAAGCTACCCAGTAGTGTCCGTGGACACAGAAT
TCCCAGGTTGCCTTCGTCCGACATCGAGGTACGCTTCCGAGGAACTCCGATTTCAGAACTTGAAGTACAACGTCGGCGCAACCTCTCTGATTCAATTAGG
GCTCACTCTGTCCAACTTCGAGGGCACCGTCGGCGGAATCTGGCAATTCAATTTCCAATTCGACCTAGACCACGACCTTCACTGCCCAAATTCAATGCAG
TTCTTGATCCTCCACGGCATCGATTTCAACAAACTGAAAACCCACGGGATTGACCGGGTCAAATTCGGCACGGCGTTCGGGAGGCTGATTGCGACAAGGC
GGAGTCCGATTACGTGGATCACTTTCCACGGCTTGTACGATTACGCTTATCTCGTGAAGGCGGTGACTTTCCGTCCGGTTGCGGAATCATCGGCGGAATT
CGTTAATTTTTTGGGGATCGGGTTTGATTCGGTGGTGGATTGCAAGTACATGGCTAAGTTCTATGAAGAGACAGGGAGTGAAATTGGGTTGCAGAAGTTA
GCGGATGCTTTGGGGGTTAAGAGAAGAGGGGAAGCTCATACTGCCGCCTCTGATAGTTTGTTGACGGCGCTGGTTTACTTTGAGTTGAAGAAGAAACTGA
TGCTGTTGGGTGTTGATGAAGAGTCTTACGTTGATTACGTCTATGGAATCAGCACCAAAATCTCCAGGAAGCAGAAAGAGCCCCTCTTTCTACCAACTGC
TCAACCAGCAGGTCCTCCTGTGTATCATCATCATCCTTATCATCCTCATCTTTATCAGAGCAAGGTGCTGTATCCCATTCCATATCAGCATAGAGAAGTA
CCCTTGCCTCCAAATGTGATGATGGGTCGTCGTTGGGTTGATTGCTCATTAGCTCCAACAGTATTAGTTCCTTCTTTCATCTACTGA
AA sequence
>Lus10017905 pacid=23148788 polypeptide=Lus10017905 locus=Lus10017905.g ID=Lus10017905.BGIv1.0 annot-version=v1.0
MAMREVWNHNFDQELHAMEVCLRSYPVVSVDTEFPGCLRPTSRYASEELRFQNLKYNVGATSLIQLGLTLSNFEGTVGGIWQFNFQFDLDHDLHCPNSMQ
FLILHGIDFNKLKTHGIDRVKFGTAFGRLIATRRSPITWITFHGLYDYAYLVKAVTFRPVAESSAEFVNFLGIGFDSVVDCKYMAKFYEETGSEIGLQKL
ADALGVKRRGEAHTAASDSLLTALVYFELKKKLMLLGVDEESYVDYVYGISTKISRKQKEPLFLPTAQPAGPPVYHHHPYHPHLYQSKVLYPIPYQHREV
PLPPNVMMGRRWVDCSLAPTVLVPSFIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06450 Polynucleotidyl transferase, r... Lus10017905 0 1
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10017970 22.2 0.6919
AT1G06450 Polynucleotidyl transferase, r... Lus10017894 25.3 0.7070
AT1G06450 Polynucleotidyl transferase, r... Lus10017895 31.4 0.6863
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10017604 85.6 0.6804
AT2G22420 Peroxidase superfamily protein... Lus10025737 111.1 0.6685
AT3G48660 Protein of unknown function (D... Lus10032028 118.2 0.6698
AT1G25220 WEI7, TRP4, ASB... WEAK ETHYLENE INSENSITIVE7, TR... Lus10030761 121.3 0.6626

Lus10017905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.