Lus10017913 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09580 421 / 1e-149 SNARE associated Golgi protein family (.1)
AT1G71940 409 / 1e-145 SNARE associated Golgi protein family (.1.2)
AT4G17790 313 / 8e-108 SNARE associated Golgi protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014818 445 / 7e-160 AT1G71940 374 / 2e-132 SNARE associated Golgi protein family (.1.2)
Lus10000905 316 / 8e-109 AT4G17790 387 / 2e-137 SNARE associated Golgi protein family (.1)
Lus10004564 315 / 1e-108 AT4G17790 388 / 1e-137 SNARE associated Golgi protein family (.1)
Lus10004421 49 / 1e-06 AT5G19070 361 / 2e-126 SNARE associated Golgi protein family (.1)
Lus10034028 49 / 2e-06 AT5G19070 363 / 3e-127 SNARE associated Golgi protein family (.1)
Lus10028016 47 / 9e-06 AT1G03260 328 / 2e-113 SNARE associated Golgi protein family (.1)
Lus10021942 40 / 0.001 AT5G19070 343 / 9e-120 SNARE associated Golgi protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G083500 442 / 2e-158 AT1G71940 460 / 1e-165 SNARE associated Golgi protein family (.1.2)
Potri.013G113000 441 / 7e-158 AT4G09580 454 / 5e-163 SNARE associated Golgi protein family (.1)
Potri.003G094000 328 / 9e-114 AT4G17790 378 / 8e-134 SNARE associated Golgi protein family (.1)
Potri.001G140200 322 / 1e-111 AT4G17790 379 / 2e-134 SNARE associated Golgi protein family (.1)
Potri.010G030800 42 / 0.0003 AT5G19070 321 / 7e-111 SNARE associated Golgi protein family (.1)
Potri.008G202600 41 / 0.0007 AT5G19070 338 / 1e-117 SNARE associated Golgi protein family (.1)
Potri.001G070800 40 / 0.0008 AT1G44960 278 / 2e-94 SNARE associated Golgi protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Lus10017913 pacid=23145643 polypeptide=Lus10017913 locus=Lus10017913.g ID=Lus10017913.BGIv1.0 annot-version=v1.0
ATGGCGGCACCTCGAAGTATTGTGGTGGAAATTGGGGGTTTGACTGGGAGTACCGGCGGCATTAACAGGATTGGAATGAGGGACGAAGAGAAGGCCAAAG
ATGACGATTCTCCGTCCAGCAAGAAATCTAAGTTGGAGAGGTTCCCCTGTTCTAGTTGGGAATTCGCTACTGCTATCTCCGTTTTCCTCTTCTTCTCCAC
GGGTTTGTTCTGCATATACCGTACAATGCCTGCTGCCGAGTACGGGAAGCTCAAAATGCCTCGCACTGTCTCGGATCTCCGATTGCTCAAAGAACATCTT
GGAACATATGCAAAAGATCATCCCGTACAGTTCATTCTCGGCTACTGCTCAACATACATCTTCATGCAGACCTTCATGATTCCAGGAACAATTTTCATGT
CATTGCTTGCTGGAGCTCTATTTGGTGTTATTAGGGGACTTTTCTTGGTTGTTTTCAATGCAACGGCGGGAGCATCTTCTTGCTTCTTTCTGTCTAAGCT
GATCGGCCGTCCTCTCGTTAGCTGGTTGTGGCCTGATAAGTTGAGATTTTTCCAAGGAGAGATAGTAAAACGTCGGGAAAAGCTACTGCATTACATGCTC
TTCTTGAGGATAACACCTACGTTGCCTAACTTATTCATCAATTTAGCATCTCCTATCGTTGACATACCGTTTCATATTTTCTTTTTGGCTACTTTGATTG
GTCTCATCCCAGCATCTTATATTACTGTGAGGGCCGGGCTTGCGCTTGGGGATCTGAAGTCGGTGAAAGATCTATACGATTTCAAAACGTTATCAGTGCT
GTTCATCATTGGCTCCATCATCATATTCCCTACACTCTTGAAAAGAAAGCGGATATACGAATGA
AA sequence
>Lus10017913 pacid=23145643 polypeptide=Lus10017913 locus=Lus10017913.g ID=Lus10017913.BGIv1.0 annot-version=v1.0
MAAPRSIVVEIGGLTGSTGGINRIGMRDEEKAKDDDSPSSKKSKLERFPCSSWEFATAISVFLFFSTGLFCIYRTMPAAEYGKLKMPRTVSDLRLLKEHL
GTYAKDHPVQFILGYCSTYIFMQTFMIPGTIFMSLLAGALFGVIRGLFLVVFNATAGASSCFFLSKLIGRPLVSWLWPDKLRFFQGEIVKRREKLLHYML
FLRITPTLPNLFINLASPIVDIPFHIFFLATLIGLIPASYITVRAGLALGDLKSVKDLYDFKTLSVLFIIGSIIIFPTLLKRKRIYE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G09580 SNARE associated Golgi protein... Lus10017913 0 1
AT2G13100 AtG3Pp5 glycerol-3-phosphate permease ... Lus10040002 3.3 0.8231
AT1G29690 CAD1 constitutively activated cell ... Lus10025235 9.3 0.8178
AT1G78620 Protein of unknown function DU... Lus10038149 13.3 0.7601
AT1G09960 ATSUC4, SUC4, A... sucrose transporter 4 (.1) Lus10032815 14.1 0.7937
AT4G17080 Histone H3 K4-specific methylt... Lus10028158 14.7 0.7840
AT5G64550 loricrin-related (.1) Lus10019307 15.0 0.7694
AT3G09770 LOG2 LOSS OF GDU 2, RING/U-box supe... Lus10023182 15.1 0.8011
AT1G50740 Transmembrane proteins 14C (.1... Lus10019624 19.1 0.7726
AT1G03350 BSD domain-containing protein ... Lus10042670 19.4 0.7941
AT5G28040 GeBP DNA-binding storekeeper protei... Lus10000940 22.6 0.7954

Lus10017913 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.