Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16195 71 / 1e-16 Plant self-incompatibility protein S1 family (.1) AT1G04645 65 / 1e-14 Plant self-incompatibility protein S1 family (.1) AT5G12060 65 / 2e-14 Plant self-incompatibility protein S1 family (.1) AT5G12070 61 / 6e-13 Plant self-incompatibility protein S1 family (.1) AT3G55672 60 / 2e-12 Plant self-incompatibility protein S1 family (.1) AT3G55252 59 / 3e-12 Plant self-incompatibility protein S1 family (.1) AT1G26799 59 / 3e-12 Plant self-incompatibility protein S1 family (.1) AT3G55677 59 / 5e-12 Plant self-incompatibility protein S1 family (.1) AT1G26795 57 / 2e-11 Plant self-incompatibility protein S1 family (.1) AT3G55665 57 / 2e-11 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008107 [exp] 145 / 5e-46 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1) Lus10013145 [exp] 127 / 1e-38 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1) Lus10030964 [exp] 72 / 3e-17 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1) Lus10030965 [exp] 70 / 1e-16 AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1) Lus10011069 [exp] 67 / 2e-15 AT4G16195 89 / 2e-23 Plant self-incompatibility protein S1 family (.1) Lus10011753 [exp] 66 / 3e-14 AT3G16970 90 / 1e-22 Plant self-incompatibility protein S1 family (.1) Lus10011068 [exp] 63 / 6e-14 AT4G16195 103 / 5e-29 Plant self-incompatibility protein S1 family (.1) Lus10022826 [exp] 62 / 2e-13 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 62 / 3e-13 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G008300 [exp] 62 / 2e-13 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 61 / 5e-13 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 59 / 1e-12 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.018G148700 [exp] 56 / 8e-11 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 53 / 9e-10 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.003G201300 [exp] 51 / 5e-09 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 50 / 1e-08 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.017G144361 [exp] 49 / 4e-08 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 46 / 2e-07 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 45 / 4e-07 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10017929 pacid=23145645 polypeptide=Lus10017929 locus=Lus10017929.g ID=Lus10017929.BGIv1.0 annot-version=v1.0 ATGGCAACGATGAAGTGCCCAATTGTGATCACAATATTATTCACGATGGCCGTAATGGTCACCATGAACGACGTTGTAAAAGCCAGCGATGATCACAATC ATCAGGTAAACTTGTTACAAAAGGTTACAGTGAAAATTACAAACAAGTTGGAAGGCGGTACTCAGCTGACGTTGCATTGCAAGTCGAAGGACGACGATCT AGGAGTTCAGGTGTTGAGATCGGGAGACGAGTTCGATTTTAAATTCGGGTTAAACTTTATGGACTCGACTCAATTCTTTTGTTCTTTTCAATGGCCTAAT GGCGACGGGATCCATTAG
AA sequence Show only first row Show all	>Lus10017929 pacid=23145645 polypeptide=Lus10017929 locus=Lus10017929.g ID=Lus10017929.BGIv1.0 annot-version=v1.0 MATMKCPIVITILFTMAVMVTMNDVVKASDDHNHQVNLLQKVTVKITNKLEGGTQLTLHCKSKDDDLGVQVLRSGDEFDFKFGLNFMDSTQFFCSFQWPN GDGIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16195			Plant self-incompatibility pro...		Lus10017929 [exp]	0	1
AT5G67090			Subtilisin-like serine endopep...		Lus10002044 [exp]	1.0	1.0000
					Lus10034545 [exp]	1.4	1.0000
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007059 [exp]	1.7	1.0000
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10016168 [exp]	2.0	1.0000
AT1G08790			Protein of unknown function (D...		Lus10042536 [exp]	2.2	0.9118
AT5G08020		ATRPA70B	ARABIDOPSIS THALIANA RPA70-KDA...		Lus10042979 [exp]	2.8	0.8222
					Lus10028981 [exp]	3.5	0.8001
AT1G17615			Disease resistance protein (TI...		Lus10018023 [exp]	4.5	0.8054
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029379 [exp]	4.6	0.8377
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Lus10022732 [exp]	5.5	0.8803

Compare expression of checked genes

Lus10017929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.