Lus10017936 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039453 56 / 5e-10 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10017936 pacid=23147997 polypeptide=Lus10017936 locus=Lus10017936.g ID=Lus10017936.BGIv1.0 annot-version=v1.0
ATGCAATCAGGCACTGATGTTGTGGCGCAAATAACTGATGGAACAGTTGCTGTCACGCAAGGAAGACAAAATTTGCCGCTCCAAAATAGAGTTTTTGTTG
TCAACAGTCGTCGTCGTAATTTTCTTGTTTCAATCTCCCTCATATGCCATCCATCGCCACCATCATCAAGCTCCTCTGTGGCCCATCGTGCGAGTTCCAA
TTCTTCGATAATCTCGCTAGCTCTTAGCGCAACAACGGAGGAGGGCTCAGGGACAATCCCGAGTCCTCACTTCGCCCCCACTCGGACGGACGCCGCCAGG
GTCGCCAGAACCGCTAGGCTTCCCGCCGCGGTCTCCAACACCGCCACCCACATTGATGTCGCCGATAGAGACAAGACGACAGCCACTACGGCCTTCGGGT
TTTTCAAAACTGGGAACAATGGTGAGGCCTCCGAAGCCTTCTACAGGGGAATCAAAGAGGAGGAATTTAAGGATGGGGAGTGCCAAGTCCCGTATCGTCC
TGATCGCCCACCAACGGGGTTAGAACCACTCAACTAA
AA sequence
>Lus10017936 pacid=23147997 polypeptide=Lus10017936 locus=Lus10017936.g ID=Lus10017936.BGIv1.0 annot-version=v1.0
MQSGTDVVAQITDGTVAVTQGRQNLPLQNRVFVVNSRRRNFLVSISLICHPSPPSSSSSVAHRASSNSSIISLALSATTEEGSGTIPSPHFAPTRTDAAR
VARTARLPAAVSNTATHIDVADRDKTTATTAFGFFKTGNNGEASEAFYRGIKEEEFKDGECQVPYRPDRPPTGLEPLN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10017936 0 1
AT1G63740 Disease resistance protein (TI... Lus10010546 1.0 0.8811
AT2G32235 unknown protein Lus10008093 1.4 0.8748
AT1G76510 ARID ARID/BRIGHT DNA-binding domain... Lus10026569 4.5 0.8255
AT1G08090 LIN1, ACH1, NRT... LATERAL ROOT INITIATION 1, nit... Lus10016120 5.0 0.8155
AT1G69480 EXS (ERD1/XPR1/SYG1) family pr... Lus10004285 6.3 0.7921
AT3G43660 Vacuolar iron transporter (VIT... Lus10029776 8.5 0.7848
AT3G50610 unknown protein Lus10009346 9.0 0.8322
Lus10011712 9.2 0.7531
AT5G46490 Disease resistance protein (TI... Lus10042465 9.4 0.7975
AT5G60770 ATNRT2.4 ARABIDOPSIS THALIANA NITRATE T... Lus10016119 9.9 0.7962

Lus10017936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.