Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29140 113 / 5e-32 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 111 / 2e-31 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 108 / 4e-30 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 100 / 2e-27 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 86 / 2e-21 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 69 / 3e-15 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G41050 44 / 9e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 43 / 2e-05 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 42 / 7e-05 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013681 [exp] 307 / 1e-108 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 303 / 5e-107 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 210 / 4e-70 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 208 / 1e-69 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 106 / 2e-29 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 106 / 2e-29 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 109 / 2e-28 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10042201 [exp] 102 / 8e-28 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 84 / 7e-21 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G111300 [exp] 171 / 4e-55 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 157 / 2e-49 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 105 / 2e-29 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 103 / 2e-28 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 100 / 2e-27 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 99 / 1e-26 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 52 / 4e-08 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 44 / 1e-05 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 44 / 2e-05 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.010G185400 [exp] 43 / 2e-05 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10017940 pacid=23147950 polypeptide=Lus10017940 locus=Lus10017940.g ID=Lus10017940.BGIv1.0 annot-version=v1.0 ATGGCAAAGACAGCAGTAGTCGCAGTCGCCGCCTTTGCCATCTTCCTCCTCGCCGCCACCTCCGCCACCGCTGCCGTCCAGAAGATGTTCGTAGAAGGCA AGGTTTACTGCGATCCTTGCCGCGTTGAGTTCCCCGTCGAAATCAGTACCTTTCTTCCAGGGGCAAAGGTGAACTTGCAATGCAGATGCAGGGAGAACAA GACAATAACGTACGAGGTGCAGGGAAAGACAGACAAGACGGGGAAGTACAGGCTACCGGTGGTTGCGGACCACGAGGAGGACTTTTGCCAGGTGAAGCTG TTGGGGAGCCCCGAGGCGGACTGCAACGAGCAATTCAAGTTCATAGACCGGGCCATGGTAGTGCTCACTGACAACATGGGTATGGCTCAGTCGACCCGCT ACGCCAACGACATTGGCTACATGAAGTCCACCACCGACCCGCGCTGCGCCAAGATCTTGCAAGACATGGGATTGAACCTTCATGAGGAACAGACCAGGTT CTTGAATTTGATCAAATCGTGA
AA sequence Show only first row Show all	>Lus10017940 pacid=23147950 polypeptide=Lus10017940 locus=Lus10017940.g ID=Lus10017940.BGIv1.0 annot-version=v1.0 MAKTAVVAVAAFAIFLLAATSATAAVQKMFVEGKVYCDPCRVEFPVEISTFLPGAKVNLQCRCRENKTITYEVQGKTDKTGKYRLPVVADHEEDFCQVKL LGSPEADCNEQFKFIDRAMVVLTDNMGMAQSTRYANDIGYMKSTTDPRCAKILQDMGLNLHEEQTRFLNLIKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29140			Pollen Ole e 1 allergen and ex...		Lus10017940 [exp]	0	1
AT3G27030			unknown protein		Lus10041551 [exp]	5.1	0.7715
AT3G54900		ATGRXCP, CXIP1	GLUTAREDOXIN, CAX interacting ...		Lus10041501 [exp]	6.9	0.7698
AT4G22320			unknown protein		Lus10032566 [exp]	12.2	0.7725
					Lus10012012 [exp]	12.7	0.7592
AT5G57710			Double Clp-N motif-containing ...		Lus10008902 [exp]	24.2	0.6783
AT1G79020			Enhancer of polycomb-like tran...		Lus10033318 [exp]	26.5	0.7324
AT5G20510	Alfin	AL5	alfin-like 5 (.1)		Lus10015637 [exp]	34.5	0.7468
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Lus10021934 [exp]	35.2	0.7545
AT3G18200			nodulin MtN21 /EamA-like trans...		Lus10021200 [exp]	37.5	0.7236
AT4G36650		ATPBRP	plant-specific TFIIB-related p...		Lus10024022 [exp]	40.7	0.7249

Compare expression of checked genes

Lus10017940 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.