Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53045 120 / 2e-37 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G011500 [exp] 131 / 2e-41 AT5G53045 135 / 7e-43 unknown protein Potri.012G017000 [exp] 129 / 8e-41 AT5G53045 136 / 3e-43 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09341 [flax] [poplar] Pcc1 Transcription factor Pcc1
Representative CDS sequence Show only first row Show all	>Lus10017942 pacid=23147866 polypeptide=Lus10017942 locus=Lus10017942.g ID=Lus10017942.BGIv1.0 annot-version=v1.0 ATGATGGTTTCCGATGACAAGTTCTCAGCCAACTTGGAAGTCGATTTCGAATCCGAAGAATACGCTTCCATTGTATATGCAGCATTGGCTGTTGATCAGG AGCTGCAGCCGGATAAAGTGAAGAGGGAAATGGTAGTCAGTGATGGCAAGTTATCAGTGTCCTTCGAGGCTGTTGAGGCAAGATTTTTGAGGGCGTCGTT CTCGGCCTTTGTTGATGTTCTCACACTTGCGACCAAGACAATCGAAGCTTTTGGGAAGGTCAAATAA
AA sequence Show only first row Show all	>Lus10017942 pacid=23147866 polypeptide=Lus10017942 locus=Lus10017942.g ID=Lus10017942.BGIv1.0 annot-version=v1.0 MMVSDDKFSANLEVDFESEEYASIVYAALAVDQELQPDKVKREMVVSDGKLSVSFEAVEARFLRASFSAFVDVLTLATKTIEAFGKVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53045			unknown protein		Lus10017942 [exp]	0	1
AT2G02880			mucin-related (.1)		Lus10012838 [exp]	1.7	0.8859
AT2G32080		PUR ALPHA-1, PU...	purin-rich alpha 1 (.1.2)		Lus10001781 [exp]	3.3	0.8948
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Lus10029426 [exp]	5.8	0.8898
AT3G16640		TCTP	translationally controlled tum...		Lus10002877 [exp]	7.4	0.8847
AT2G27490		ATCOAE	dephospho-CoA kinase family (....		Lus10002109 [exp]	10.4	0.8797
					Lus10034896 [exp]	12.6	0.8057
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Lus10004221 [exp]	12.7	0.8628
AT5G58920			unknown protein		Lus10040699 [exp]	13.6	0.8484
AT3G19130		ATRBP47B	RNA-binding protein 47B (.1)		Lus10014029 [exp]	14.8	0.8584
AT3G16640		TCTP	translationally controlled tum...		Lus10033959 [exp]	15.1	0.8405

Compare expression of checked genes

Lus10017942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.