Lus10017947 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G63130 112 / 3e-32 Octicosapeptide/Phox/Bem1p family protein (.1)
AT3G48240 103 / 1e-28 Octicosapeptide/Phox/Bem1p family protein (.1)
AT3G26510 90 / 3e-23 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT1G70640 84 / 3e-21 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT3G46920 77 / 4e-17 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G35050 75 / 1e-16 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT4G05150 74 / 4e-16 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G57610 71 / 4e-15 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT5G49920 70 / 4e-15 Octicosapeptide/Phox/Bem1p family protein (.1)
AT1G79570 70 / 9e-15 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043341 104 / 6e-29 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10019490 102 / 8e-28 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10026700 93 / 2e-24 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10002938 89 / 4e-23 AT3G48240 130 / 1e-38 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10010753 77 / 9e-19 AT5G09620 182 / 5e-56 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10019577 81 / 2e-18 AT3G46920 606 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10035641 78 / 2e-18 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10040006 80 / 3e-18 AT3G46920 604 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10002588 78 / 1e-17 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G085000 112 / 2e-32 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.015G083400 109 / 4e-31 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.008G186500 100 / 6e-27 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.010G046400 94 / 2e-24 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.004G032200 79 / 5e-18 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.006G190200 79 / 6e-18 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.009G080200 79 / 7e-18 AT5G64430 281 / 6e-89 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.001G285800 78 / 1e-17 AT5G64430 270 / 8e-85 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.011G041100 77 / 2e-17 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.003G110000 77 / 4e-17 AT2G35050 672 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10017947 pacid=23147870 polypeptide=Lus10017947 locus=Lus10017947.g ID=Lus10017947.BGIv1.0 annot-version=v1.0
ATGGTCAGCGAGAATCACTCGTCCAAGAACACCACCACGCTCTCCAAGACAACCGTCAAGTACCTCTGCAGCTACGGCGGGAAGATCGCCCCTCGTCCCT
CCGACGGGCAGCTCCGTTACGTCGGCGGACACACCAGAGTGCTCGCTGCCGATCGCTCCCTTTCATTCGCCGAGCTGTTGATTAAGATCGCCGAGTTCTG
CGGTCAGTCAGTGGAATTGAGGTGTCAATTGCCAAACGGAGATCTAGAGACGCTGGTTTCCCCGGGGGCGATCTGTTCCCCTGCGGGGGGCCGTGGAGGT
TCCGGGAGAGGTCATTACAGTAGTCCGCGGTATCCAATCGGAATGGGACAGCGCGTCCAGCAAGACAATCTGCTATGCAGATATAGATTTTACTTCTTTT
AA
AA sequence
>Lus10017947 pacid=23147870 polypeptide=Lus10017947 locus=Lus10017947.g ID=Lus10017947.BGIv1.0 annot-version=v1.0
MVSENHSSKNTTTLSKTTVKYLCSYGGKIAPRPSDGQLRYVGGHTRVLAADRSLSFAELLIKIAEFCGQSVELRCQLPNGDLETLVSPGAICSPAGGRGG
SGRGHYSSPRYPIGMGQRVQQDNLLCRYRFYFF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G63130 Octicosapeptide/Phox/Bem1p fam... Lus10017947 0 1
AT1G47410 unknown protein Lus10009767 2.8 0.9356
AT4G16820 PLA-I{beta]2 phospholipase A I beta 2, alph... Lus10040158 3.5 0.9138
AT4G21410 CRK29 cysteine-rich RLK (RECEPTOR-li... Lus10007635 3.9 0.8945
AT5G10930 CIPK5, SnRK3.24 SNF1-RELATED PROTEIN KINASE 3.... Lus10041653 4.2 0.9339
AT4G23496 SP1L5 SPIRAL1-like5 (.1) Lus10024667 4.9 0.9265
AT5G20650 COPT5 copper transporter 5 (.1) Lus10040925 8.1 0.8983
AT1G47410 unknown protein Lus10006481 8.4 0.8998
AT5G47635 Pollen Ole e 1 allergen and ex... Lus10039078 9.8 0.9042
AT2G01300 unknown protein Lus10009104 11.8 0.8843
AT1G18740 Protein of unknown function (D... Lus10018883 12.0 0.8986

Lus10017947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.