Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37000 52 / 3e-09 ATRCCR, ACD2 ARABIDOPSIS THALIANA RED CHLOROPHYLL CATABOLITE REDUCTASE, accelerated cell death 2 (ACD2) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009352 [exp] 79 / 1e-18 AT4G37000 284 / 6e-95 ARABIDOPSIS THALIANA RED CHLOROPHYLL CATABOLITE REDUCTASE, accelerated cell death 2 (ACD2) (.1) Lus10019349 [exp] 79 / 1e-18 AT4G37000 289 / 4e-94 ARABIDOPSIS THALIANA RED CHLOROPHYLL CATABOLITE REDUCTASE, accelerated cell death 2 (ACD2) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G043700 [exp] 46 / 4e-07 AT4G37000 206 / 3e-64 ARABIDOPSIS THALIANA RED CHLOROPHYLL CATABOLITE REDUCTASE, accelerated cell death 2 (ACD2) (.1) Potri.007G043500 [exp] 43 / 4e-06 AT4G37000 178 / 1e-54 ARABIDOPSIS THALIANA RED CHLOROPHYLL CATABOLITE REDUCTASE, accelerated cell death 2 (ACD2) (.1) Potri.007G043600 [exp] 44 / 5e-06 AT4G37000 292 / 5e-98 ARABIDOPSIS THALIANA RED CHLOROPHYLL CATABOLITE REDUCTASE, accelerated cell death 2 (ACD2) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06405 [flax] [poplar] RCC_reductase Red chlorophyll catabolite reductase (RCC reductase)
Representative CDS sequence Show only first row Show all	>Lus10017952 pacid=23147879 polypeptide=Lus10017952 locus=Lus10017952.g ID=Lus10017952.BGIv1.0 annot-version=v1.0 ATGGCATCAGAGAAATTGTCAGGTTCGTCGGATCTGCTCTTCTCTCCCACCCCAATCATCGTAGGGATAGATGCAGAGGAGACTGATCGAATCGGTCAGA TCTTGGTGGACGATGTGCAAAAAGCGGCGAAGGAAGTTGTGAGTCTGTGGATTGAGAAGTGTGTGTTCAGGGAGGAAGGGAAGGAAATGGTGAAGGAGGA AGTTGTGTTAGTGTGGTTAAAGAAGAGGGATGGTTTGGTTAAGGGGAAGACGATGGAGGTAGATCTATGTTCGGATTTTCCAAGCTGTAAAGGGTAA
AA sequence Show only first row Show all	>Lus10017952 pacid=23147879 polypeptide=Lus10017952 locus=Lus10017952.g ID=Lus10017952.BGIv1.0 annot-version=v1.0 MASEKLSGSSDLLFSPTPIIVGIDAEETDRIGQILVDDVQKAAKEVVSLWIEKCVFREEGKEMVKEEVVLVWLKKRDGLVKGKTMEVDLCSDFPSCKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37000		ATRCCR, ACD2	ARABIDOPSIS THALIANA RED CHLOR...		Lus10017952 [exp]	0	1
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10035628 [exp]	3.2	0.8986
					Lus10003879 [exp]	7.7	0.8571
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10026009 [exp]	9.7	0.8793
					Lus10033284 [exp]	10.5	0.8737
					Lus10025164 [exp]	11.3	0.8592
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10028979 [exp]	12.2	0.8198
AT3G53940			Mitochondrial substrate carrie...		Lus10012658 [exp]	13.0	0.8392
					Lus10008926 [exp]	13.3	0.7713
					Lus10018996 [exp]	15.7	0.8586
AT5G45380		ATDUR3	DEGRADATION OF UREA 3, solute:...		Lus10033882 [exp]	21.0	0.8508

Compare expression of checked genes

Lus10017952 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.