Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006897 [exp] 91 / 9e-26 ND / Lus10041943 [exp] 81 / 5e-22 ND / Lus10041941 [exp] 80 / 1e-21 ND / Lus10041944 [exp] 71 / 4e-18 ND / Lus10017955 [exp] 68 / 6e-17 ND / Lus10019472 [exp] 54 / 7e-11 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G085901 [exp] 56 / 4e-12 ND / Potri.012G086200 [exp] 46 / 3e-08 ND / Potri.015G084101 [exp] 46 / 4e-08 ND / Potri.012G085800 [exp] 46 / 9e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017954 pacid=23147888 polypeptide=Lus10017954 locus=Lus10017954.g ID=Lus10017954.BGIv1.0 annot-version=v1.0 ATGGACCAGAACACCCATAATTACCACACCTATATATCGGCGATGATGCGGGCTCCCAGCATCATGTACGGCGTTCCTCAGTACCCGGACGTCCACAAGG CCTTCAAGCACGATCCGGCTTACTACTACTACGAACAAGAGCAGAAGCAGAAGCAGCAGCAAGAGCTAGAGCAGCAGAAGAAGAACAAGAAGAAGAAGAT TTTCGAGCTCTGCAAATGGAAGACCTTCAGGCTTTGA
AA sequence Show only first row Show all	>Lus10017954 pacid=23147888 polypeptide=Lus10017954 locus=Lus10017954.g ID=Lus10017954.BGIv1.0 annot-version=v1.0 MDQNTHNYHTYISAMMRAPSIMYGVPQYPDVHKAFKHDPAYYYYEQEQKQKQQQELEQQKKNKKKKIFELCKWKTFRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017954 [exp]	0	1
AT1G10380			Putative membrane lipoprotein ...		Lus10037236 [exp]	1.7	0.9358
AT1G01490			Heavy metal transport/detoxifi...		Lus10027522 [exp]	3.0	0.9255
AT1G69880		ATH8	thioredoxin H-type 8 (.1)		Lus10037225 [exp]	3.2	0.9502
AT1G24620			EF hand calcium-binding protei...		Lus10007816 [exp]	3.2	0.9363
					Lus10025225 [exp]	4.9	0.9311
AT1G69260		AFP1	ABI five binding protein (.1)		Lus10036898 [exp]	6.3	0.8928
AT1G69970		CLE26	CLAVATA3/ESR-RELATED 26 (.1.2)		Lus10010735 [exp]	7.4	0.9346
					Lus10010378 [exp]	8.2	0.9348
AT4G15210		BAM5, AT-BETA-A...	REDUCED BETA AMYLASE 1, ARABID...		Lus10039701 [exp]	8.7	0.9105
AT4G15210		BAM5, AT-BETA-A...	REDUCED BETA AMYLASE 1, ARABID...		Lus10039702 [exp]	9.9	0.9306

Compare expression of checked genes

Lus10017954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.