Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041944 [exp] 122 / 1e-38 ND / Lus10041941 [exp] 70 / 6e-18 ND / Lus10006897 [exp] 68 / 5e-17 ND / Lus10017954 [exp] 68 / 9e-17 ND / Lus10041943 [exp] 68 / 1e-16 ND / Lus10019472 [exp] 60 / 1e-13 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G085901 [exp] 68 / 8e-17 ND / Potri.012G086200 [exp] 49 / 1e-09 ND / Potri.012G085800 [exp] 49 / 7e-09 ND / Potri.015G084101 [exp] 47 / 9e-09 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017955 pacid=23147930 polypeptide=Lus10017955 locus=Lus10017955.g ID=Lus10017955.BGIv1.0 annot-version=v1.0 ATGGACAGAAGATCCCATGATTTCCACGCCCACATATCGGCGATGCTGAAGCCCCCCAGCATCATGCACGGCGTTCCTCAGTACCCAAACGTCCACAAGG CATTCAAACACGACCCCTACAACACGGAAGGGCAGCAGCAGCAGAAACAGAGGGGTTTCAAGCTCTGCAAATGGAAGAATCCTGACGGCTGCCTTGATCA GATGTGA
AA sequence Show only first row Show all	>Lus10017955 pacid=23147930 polypeptide=Lus10017955 locus=Lus10017955.g ID=Lus10017955.BGIv1.0 annot-version=v1.0 MDRRSHDFHAHISAMLKPPSIMHGVPQYPNVHKAFKHDPYNTEGQQQQKQRGFKLCKWKNPDGCLDQM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017955 [exp]	0	1
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	1.0	0.9939
AT2G24960			unknown protein		Lus10042421 [exp]	2.0	0.9866
					Lus10002859 [exp]	2.4	0.9844
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10026811 [exp]	2.8	0.9816
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10008669 [exp]	4.0	0.9721
AT4G10790			UBX domain-containing protein ...		Lus10039951 [exp]	4.0	0.9659
					Lus10035062 [exp]	4.9	0.9761
AT1G63740			Disease resistance protein (TI...		Lus10007834 [exp]	5.0	0.9589
AT3G58880			F-box/RNI-like superfamily pro...		Lus10020329 [exp]	5.3	0.9572
					Lus10039496 [exp]	6.3	0.9768

Compare expression of checked genes

Lus10017955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.