Lus10017992 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18570 114 / 3e-32 Oleosin family protein (.1)
AT1G48990 97 / 1e-25 Oleosin family protein (.1)
AT2G25890 61 / 7e-12 Oleosin family protein (.1)
AT4G25140 60 / 2e-11 OLE1, OLEO1 oleosin 1 (.1)
AT5G51210 57 / 1e-10 OLEO3 oleosin3 (.1)
AT5G40420 49 / 2e-07 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G27660 49 / 2e-07 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041987 257 / 3e-88 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Lus10032461 130 / 1e-38 AT3G18570 142 / 1e-43 Oleosin family protein (.1)
Lus10042957 126 / 8e-37 AT3G18570 139 / 2e-42 Oleosin family protein (.1)
Lus10027161 74 / 1e-16 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10031387 73 / 2e-16 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10039683 70 / 4e-15 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10010943 71 / 3e-14 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10028822 64 / 2e-13 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10017460 64 / 7e-13 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G059400 131 / 4e-39 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
Potri.001G080000 72 / 2e-16 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.006G234900 72 / 2e-16 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.015G081901 67 / 3e-14 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.T125308 67 / 3e-14 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.012G083400 64 / 5e-13 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.018G057800 64 / 5e-13 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.003G150600 62 / 2e-12 AT4G25140 124 / 3e-37 oleosin 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10017992 pacid=23147977 polypeptide=Lus10017992 locus=Lus10017992.g ID=Lus10017992.BGIv1.0 annot-version=v1.0
ATGGCTGACCACCGTCCTACCGTAGGCTCAGCACGCTCCACGCGCCCACCAACCTCCCCATCACTCACCACCGCCGCCGCCACCTCCTCCTCCCACCCAA
CCATCTCCGCCGCAGCCGCCTTCCTCCACAGACTCCAAACTTTAATCCAGCGCCATGCACCGGGAAACACCGCCTCCACCCAGCTCATCGGCCTACTAAC
TCTCTTCATCACCGGCTCCATCCTCCTCCTCCTCACCGGCGCCACCGTCGCTGTATTTGTCGTCTCCTTGATCTTCCTCGCCCCGATCCTCATCGTGTTC
AGCCCGATATGGGTCCCGGTGGCCACTCTCTTGTTCGTCCTGGTGACCGGGTTCCTGACGTTCGCCGGGTTCGTGGTGGCGTTGGTCGGCGGGCTGTCGT
GGGGGTATCGGTACTACCGAGGGATGAACCCGGTGGGGTCGGACCGGTTCGATTACGCGAGGGAGCGGATTTCGGATACGGCGGGAGCGGTCAAGGAGTA
CGCTAGGGAGTACGGTGGGTATTTCCAGAGTAAGGTCAAGGATGCGGCTCCAGGTGCTTGA
AA sequence
>Lus10017992 pacid=23147977 polypeptide=Lus10017992 locus=Lus10017992.g ID=Lus10017992.BGIv1.0 annot-version=v1.0
MADHRPTVGSARSTRPPTSPSLTTAAATSSSHPTISAAAAFLHRLQTLIQRHAPGNTASTQLIGLLTLFITGSILLLLTGATVAVFVVSLIFLAPILIVF
SPIWVPVATLLFVLVTGFLTFAGFVVALVGGLSWGYRYYRGMNPVGSDRFDYARERISDTAGAVKEYAREYGGYFQSKVKDAAPGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18570 Oleosin family protein (.1) Lus10017992 0 1
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10028502 1.7 0.9244
AT3G12910 NAC NAC (No Apical Meristem) domai... Lus10031766 2.4 0.8948
Lus10014377 3.7 0.8942
AT5G49450 bZIP ATBZIP1 basic leucine-zipper 1 (.1) Lus10037750 8.2 0.9155
AT3G16150 ASPGB1 asparaginase B1, N-terminal nu... Lus10024795 10.2 0.8642
AT4G13830 J20 DNAJ-like 20 (.1.2) Lus10002356 10.2 0.9042
AT4G36670 AtPMT6, AtPLT6 polyol/monosaccharide transpor... Lus10041731 11.5 0.9103
AT5G59340 HD WOX2 WUSCHEL related homeobox 2 (.1... Lus10016569 12.7 0.8628
AT1G31260 ZIP10 zinc transporter 10 precursor ... Lus10040615 13.6 0.8548
AT3G16350 MYB Homeodomain-like superfamily p... Lus10037560 16.9 0.8837

Lus10017992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.