Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18880 160 / 2e-52 Nucleic acid-binding, OB-fold-like protein (.1) AT1G49400 153 / 1e-49 EMB1129 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1) AT1G79850 55 / 1e-10 PDE347, CS17, PRPS17, ORE4, RPS17 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) AT4G30800 42 / 7e-06 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017467 [exp] 175 / 2e-58 AT3G18880 154 / 2e-50 Nucleic acid-binding, OB-fold-like protein (.1) Lus10028815 [exp] 160 / 1e-52 AT3G18880 154 / 4e-50 Nucleic acid-binding, OB-fold-like protein (.1) Lus10035863 [exp] 52 / 2e-09 AT1G79850 131 / 6e-40 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) Lus10025799 [exp] 51 / 3e-09 AT1G79850 133 / 9e-41 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G080200 [exp] 171 / 4e-57 AT3G18880 155 / 1e-50 Nucleic acid-binding, OB-fold-like protein (.1) Potri.018G150100 [exp] 167 / 2e-55 AT1G49400 152 / 4e-49 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1) Potri.001G184000 [exp] 45 / 1e-06 AT1G79850 139 / 1e-42 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF00366 [flax] [poplar] Ribosomal_S17 Ribosomal protein S17
Representative CDS sequence Show only first row Show all	>Lus10017993 pacid=23147856 polypeptide=Lus10017993 locus=Lus10017993.g ID=Lus10017993.BGIv1.0 annot-version=v1.0 ATGAAGTCGGTGGTGGGAGTCGTGGTTTCGAACAAGATGCAGAAGTCGGTGGTGGTCGCCGTCGATAGGCTCTTCCACAATAAGGTTTACAATCGCTACG TCAAGCGCACGTCCAAGTTCATGGCCCACGACGAGAACGACGCCTGCAACATTGGTGATCGTGTGAAGCTGGATCCTTCGCGGCCGTTGAGCAAACACAA GCGGTGGATCGTAGCTGACATTCTTAAGAAGGCTCGGATCTACGTTCCTCCTTCCGCTGCTGGTAATACGACTACTGCTGCTGAATCTGAACTCGCAAAA TCCTCAACAACCTCTTAA
AA sequence Show only first row Show all	>Lus10017993 pacid=23147856 polypeptide=Lus10017993 locus=Lus10017993.g ID=Lus10017993.BGIv1.0 annot-version=v1.0 MKSVVGVVVSNKMQKSVVVAVDRLFHNKVYNRYVKRTSKFMAHDENDACNIGDRVKLDPSRPLSKHKRWIVADILKKARIYVPPSAAGNTTTAAESELAK SSTTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18880			Nucleic acid-binding, OB-fold-...		Lus10017993 [exp]	0	1
AT5G46160			Ribosomal protein L14p/L23e fa...		Lus10038513 [exp]	6.9	0.8826
AT2G28690			Protein of unknown function (D...		Lus10005884 [exp]	12.0	0.8614
AT1G70560		CKRC1, WEI8, TA...	WEAK ETHYLENE INSENSITIVE 8, S...		Lus10006199 [exp]	16.9	0.8753
AT5G59950			RNA-binding (RRM/RBD/RNP motif...		Lus10004946 [exp]	24.7	0.8428
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Lus10023733 [exp]	27.2	0.8627
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10037663 [exp]	30.1	0.8473
AT1G56450		PBG1	20S proteasome beta subunit G1...		Lus10036124 [exp]	30.9	0.8465
AT1G70190			Ribosomal protein L7/L12, olig...		Lus10038367 [exp]	39.7	0.8499
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031979 [exp]	40.5	0.8596
AT5G27660			Trypsin family protein with PD...		Lus10037815 [exp]	41.6	0.7815

Compare expression of checked genes

Lus10017993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.