Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18070 107 / 4e-29 BGLU43 beta glucosidase 43 (.1.2) AT3G18080 108 / 5e-29 BGLU44 B-S glucosidase 44 (.1) AT1G61820 87 / 1e-21 BGLU46 beta glucosidase 46 (.1.3) AT4G21760 75 / 3e-17 BGLU47 beta-glucosidase 47 (.1) AT1G61810 74 / 6e-17 BGLU45 beta-glucosidase 45 (.1.2.3) AT5G36890 73 / 2e-16 BGLU42 beta glucosidase 42 (.1.2) AT5G24550 69 / 5e-15 BGLU32 beta glucosidase 32 (.1) AT5G44640 67 / 1e-14 BGLU13 beta glucosidase 13 (.1) AT5G24540 67 / 2e-14 BGLU31 beta glucosidase 31 (.1) AT2G44450 67 / 3e-14 BGLU15 beta glucosidase 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009013 [exp] 115 / 2e-32 AT3G18080 516 / 0.0 B-S glucosidase 44 (.1) Lus10009644 [exp] 114 / 5e-31 AT3G18080 812 / 0.0 B-S glucosidase 44 (.1) Lus10020234 [exp] 74 / 7e-18 AT5G36890 217 / 2e-69 beta glucosidase 42 (.1.2) Lus10032659 [exp] 75 / 3e-17 AT4G21760 300 / 2e-97 beta-glucosidase 47 (.1) Lus10000225 [exp] 74 / 4e-17 AT4G21760 189 / 1e-55 beta-glucosidase 47 (.1) Lus10032660 [exp] 74 / 6e-17 AT4G21760 525 / 6e-175 beta-glucosidase 47 (.1) Lus10020232 [exp] 74 / 9e-17 AT5G36890 699 / 0.0 beta glucosidase 42 (.1.2) Lus10018354 [exp] 73 / 2e-16 AT4G21760 462 / 1e-159 beta-glucosidase 47 (.1) Lus10026861 [exp] 71 / 2e-16 AT5G36890 236 / 4e-76 beta glucosidase 42 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G049300 [exp] 108 / 5e-29 AT3G18080 831 / 0.0 B-S glucosidase 44 (.1) Potri.015G041300 [exp] 103 / 2e-27 AT3G18080 839 / 0.0 B-S glucosidase 44 (.1) Potri.003G211100 [exp] 81 / 4e-19 AT5G44640 569 / 0.0 beta glucosidase 13 (.1) Potri.T085301 [exp] 81 / 4e-19 AT5G44640 575 / 0.0 beta glucosidase 13 (.1) Potri.010G178800 [exp] 77 / 9e-18 AT5G36890 714 / 0.0 beta glucosidase 42 (.1.2) Potri.004G019800 [exp] 76 / 2e-17 AT4G21760 658 / 0.0 beta-glucosidase 47 (.1) Potri.001G403900 [exp] 74 / 5e-17 AT4G21760 516 / 7e-180 beta-glucosidase 47 (.1) Potri.004G019700 [exp] 74 / 8e-17 AT1G61820 655 / 0.0 beta glucosidase 46 (.1.3) Potri.001G015100 [exp] 74 / 9e-17 AT5G44640 553 / 0.0 beta glucosidase 13 (.1) Potri.004G019300 [exp] 74 / 1e-16 AT1G61820 636 / 0.0 beta glucosidase 46 (.1.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00232 [flax] [poplar] Glyco_hydro_1 Glycosyl hydrolase family 1
Representative CDS sequence Show only first row Show all	>Lus10017997 pacid=23147864 polypeptide=Lus10017997 locus=Lus10017997.g ID=Lus10017997.BGIv1.0 annot-version=v1.0 ATGTATGTGAAGGAGCGGGATCAATCGGGCAATGTAACACTTCCAAAGGTGTTGCACGTCACAGAGAGGATCAAGTACTATAAGGGCTACTTGGCACAAC GGAAGAAGTCCATCGACGATGGAGCCAATGTGACGGGTTACTTCGCGTGGTCAATGATTGACAACTTCGAGTGGCTGTCGGGATTTACCTCGAAATTCAG GATCGACTTCGAGCCTCTAGAGAGGACTCCCAATATATTGGCCTACTGGTTCAAGACACTGCTCGATTATAGCAAACACTGA
AA sequence Show only first row Show all	>Lus10017997 pacid=23147864 polypeptide=Lus10017997 locus=Lus10017997.g ID=Lus10017997.BGIv1.0 annot-version=v1.0 MYVKERDQSGNVTLPKVLHVTERIKYYKGYLAQRKKSIDDGANVTGYFAWSMIDNFEWLSGFTSKFRIDFEPLERTPNILAYWFKTLLDYSKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	1.4	1.0000
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	2.0	1.0000
					Lus10032804 [exp]	2.8	0.9674
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	3.0	1.0000
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10005599 [exp]	3.6	0.8996
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	4.0	1.0000
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021456 [exp]	4.5	0.9956
AT1G55790			Domain of unknown function (DU...		Lus10032900 [exp]	4.9	0.9846
AT3G46290		HERK1	hercules receptor kinase 1 (.1...		Lus10023325 [exp]	5.2	0.9539
AT4G22200		AKT3, AKT2/3	potassium transport 2/3 (.1)		Lus10003644 [exp]	5.5	0.8676

Compare expression of checked genes

Lus10017997 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.