Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042010 [exp] 108 / 5e-33 ND / Lus10018015 [exp] 69 / 6e-17 ND / Lus10042011 [exp] 67 / 2e-16 ND / Lus10031026 [exp] 58 / 8e-13 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G044300 [exp] 58 / 6e-13 ND / Potri.016G041301 [exp] 46 / 4e-08 ND / Potri.006G044200 [exp] 42 / 1e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018014 pacid=23147972 polypeptide=Lus10018014 locus=Lus10018014.g ID=Lus10018014.BGIv1.0 annot-version=v1.0 ATGGCCGGTCTTCAGTACAACTTCTTCCCAACCGACTTCTTCTACCCTCGCCCCGCGTCTGTCGCCGGAGCTGCAGAAGCGGCCAAGAAGTCGTCCCTTC CTATGCAGATCCAGAAGCGATCCGACGCCGATTGCCAACACGACGTGATCAGTCACCCCGCCAGACTGGTCCTCCACACCAACGCCAACAAGTCCGCCGT CGCCGTCGCCGCCGTAGAGAACAAGAGGAGGAAGTGA
AA sequence Show only first row Show all	>Lus10018014 pacid=23147972 polypeptide=Lus10018014 locus=Lus10018014.g ID=Lus10018014.BGIv1.0 annot-version=v1.0 MAGLQYNFFPTDFFYPRPASVAGAAEAAKKSSLPMQIQKRSDADCQHDVISHPARLVLHTNANKSAVAVAAVENKRRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018014 [exp]	0	1
AT3G51520			diacylglycerol acyltransferase...		Lus10039135 [exp]	6.1	0.9410
AT5G46080			Protein kinase superfamily pro...		Lus10015326 [exp]	6.3	0.9225
AT1G30090			Galactose oxidase/kelch repeat...		Lus10042824 [exp]	6.7	0.9192
AT1G51700	DOF	ADOF1, AtDof1. ...	DOF zinc finger protein 1 (.1)		Lus10035504 [exp]	7.9	0.8989
AT3G48990			AMP-dependent synthetase and l...		Lus10027477 [exp]	10.6	0.9185
AT3G47550			RING/FYVE/PHD zinc finger supe...		Lus10019102 [exp]	11.0	0.9348
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10042857 [exp]	15.1	0.9157
AT2G02870			Galactose oxidase/kelch repeat...		Lus10036735 [exp]	15.9	0.8987
AT1G65820			microsomal glutathione s-trans...		Lus10007375 [exp]	16.6	0.9275
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10032574 [exp]	17.3	0.9011

Compare expression of checked genes

Lus10018014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.