Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042011 [exp] 154 / 5e-51 ND / Lus10042010 [exp] 99 / 5e-29 ND / Lus10018014 [exp] 85 / 2e-23 ND / Lus10031026 [exp] 67 / 3e-16 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G044300 [exp] 62 / 2e-14 ND / Potri.016G041301 [exp] 61 / 5e-14 ND / Potri.006G044200 [exp] 47 / 4e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018015 pacid=23147927 polypeptide=Lus10018015 locus=Lus10018015.g ID=Lus10018015.BGIv1.0 annot-version=v1.0 ATGGCCGGTCTGCAGTACAACTTCTTCCCAACCGACTTCTTCTACCCTCGCCCAACGTCCGTCGCCGGAGCAGCAGAATCCGCCGGCCAGAAATCGTCCC TTCCTCTGCAGGTCCAGAAGTGGCCAGATGTCGATCACCACCGTGATGTGAATCACCCCACCGGTTTAGTCCTCCGTACCACCACTAAAAATTTCGCGGG AGCCGGCGTCGCCGCCGTAGAGAATAAGAGGAAGAAGAAATACCATCACCTGGATGGGTAA
AA sequence Show only first row Show all	>Lus10018015 pacid=23147927 polypeptide=Lus10018015 locus=Lus10018015.g ID=Lus10018015.BGIv1.0 annot-version=v1.0 MAGLQYNFFPTDFFYPRPTSVAGAAESAGQKSSLPLQVQKWPDVDHHRDVNHPTGLVLRTTTKNFAGAGVAAVENKRKKKYHHLDG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018015 [exp]	0	1
AT3G53720		ATCHX20	cation/H+ exchanger 20, cation...		Lus10024414 [exp]	1.4	0.9286
AT5G55340			MBOAT (membrane bound O-acyl t...		Lus10022293 [exp]	2.4	0.8723
AT3G53720		ATCHX20	cation/H+ exchanger 20, cation...		Lus10025324 [exp]	4.2	0.8702
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Lus10006747 [exp]	5.0	0.8672
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10002853 [exp]	5.3	0.8694
AT2G19130			S-locus lectin protein kinase ...		Lus10031597 [exp]	8.7	0.8121
AT5G10530			Concanavalin A-like lectin pro...		Lus10016833 [exp]	8.9	0.8202
AT2G19570		DESZ, AT-CDA1, ...	cytidine deaminase 1 (.1)		Lus10007654 [exp]	11.7	0.8369
AT3G19450		CAD-C, ATCAD4	CINNAMYL ALCOHOL DEHYDROGENASE...		Lus10019811 [exp]	12.0	0.8644
AT4G29120			6-phosphogluconate dehydrogena...		Lus10034975 [exp]	14.0	0.8312

Compare expression of checked genes

Lus10018015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.