Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74670 108 / 7e-32 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 89 / 3e-24 GASA4 GAST1 protein homolog 4 (.1.2) AT2G30810 88 / 8e-24 Gibberellin-regulated family protein (.1) AT3G10185 86 / 4e-23 Gibberellin-regulated family protein (.1) AT3G02885 84 / 3e-22 GASA5 GAST1 protein homolog 5 (.1) AT2G39540 77 / 1e-19 Gibberellin-regulated family protein (.1) AT1G10588 72 / 1e-17 Gibberellin-regulated family protein (.1.2) AT5G59845 68 / 4e-16 Gibberellin-regulated family protein (.1) AT2G14900 62 / 1e-13 Gibberellin-regulated family protein (.1) AT1G22690 61 / 7e-13 Gibberellin-regulated family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042012 [exp] 187 / 2e-62 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042203 [exp] 103 / 5e-30 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10008612 [exp] 103 / 6e-30 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10004048 [exp] 103 / 8e-30 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10002059 [exp] 102 / 2e-29 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 101 / 4e-29 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10030680 [exp] 100 / 3e-28 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10005241 [exp] 96 / 1e-26 ND 96 / 4e-27 Lus10024216 [exp] 95 / 6e-26 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G044400 [exp] 141 / 1e-44 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 122 / 3e-37 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 100 / 8e-29 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.001G315500 [exp] 93 / 8e-26 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.017G083000 [exp] 79 / 3e-20 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2) Potri.014G020100 [exp] 70 / 7e-17 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 61 / 4e-13 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G297700 [exp] 60 / 6e-13 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.002G022700 [exp] 60 / 1e-12 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.019G083900 [exp] 59 / 3e-12 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10018016 pacid=23147938 polypeptide=Lus10018016 locus=Lus10018016.g ID=Lus10018016.BGIv1.0 annot-version=v1.0 ATGGAGATCAAGAGAATGTACTACAACTTTGTGTTTGCTTTCCTTCTTCTCAACATTCTTATACTTCACAACCACGCTGCAGCAGCTATCTTCGAATCGC CAGCACCCCAACCTCAACCCAACAATGGCAGTAACAGTACTAACACCCTCCCTTCTACTGGAACAACTGAAGGAAGCCTTCATCCTCAAGACTGTGGAGG GAGATGCGGGGTTCGATGCTCAAAGACACAATACAAGAAGCCATGCATGTTCTTCTGCCAAAAGTGCTGTGCAAAGTGCCTCTGTGTCCCTTCTGGTACT TACGGCCACAAGCAATCCTGCCCTTGCTACAATAACTGGAAAACCAAACGTGGTGGCCCTAAATGCCCTTGA
AA sequence Show only first row Show all	>Lus10018016 pacid=23147938 polypeptide=Lus10018016 locus=Lus10018016.g ID=Lus10018016.BGIv1.0 annot-version=v1.0 MEIKRMYYNFVFAFLLLNILILHNHAAAAIFESPAPQPQPNNGSNSTNTLPSTGTTEGSLHPQDCGGRCGVRCSKTQYKKPCMFFCQKCCAKCLCVPSGT YGHKQSCPCYNNWKTKRGGPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10018016 [exp]	0	1
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10016815 [exp]	3.5	0.9146
AT5G03080			Phosphatidic acid phosphatase ...		Lus10019919 [exp]	3.5	0.9245
AT3G45230			hydroxyproline-rich glycoprote...		Lus10041306 [exp]	5.5	0.9243
					Lus10040587 [exp]	7.1	0.9229
AT2G34700			Pollen Ole e 1 allergen and ex...		Lus10014013 [exp]	9.5	0.9105
AT3G52760			Integral membrane Yip1 family ...		Lus10017054 [exp]	12.6	0.9147
AT3G14240			Subtilase family protein (.1)		Lus10013187 [exp]	14.4	0.9065
AT4G24910			Protein of unknown function (D...		Lus10002345 [exp]	15.9	0.9163
AT5G17390			Adenine nucleotide alpha hydro...		Lus10034661 [exp]	16.4	0.9127
AT2G29340			NAD-dependent epimerase/dehydr...		Lus10004985 [exp]	23.4	0.9140

Compare expression of checked genes

Lus10018016 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.