Lus10018018 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41430 103 / 1e-28 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
AT4G14270 71 / 4e-16 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042014 232 / 9e-80 AT2G41430 99 / 1e-27 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10031029 162 / 3e-52 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10035419 157 / 1e-50 AT2G41430 113 / 2e-33 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10016358 93 / 2e-24 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10019769 90 / 2e-23 AT2G41430 91 / 1e-23 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10040964 66 / 3e-14 AT2G41430 69 / 2e-15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10009847 56 / 2e-10 AT2G41430 63 / 3e-13 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G041600 140 / 3e-43 AT2G41430 121 / 1e-35 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.006G044600 137 / 4e-42 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.001G023100 94 / 8e-25 AT4G14270 89 / 3e-23 unknown protein
Potri.003G202500 87 / 2e-22 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.010G182800 63 / 3e-13 AT4G14270 65 / 6e-14 unknown protein
Potri.008G074600 62 / 1e-12 AT4G14270 66 / 2e-14 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07145 PAM2 Ataxin-2 C-terminal region
Representative CDS sequence
>Lus10018018 pacid=23147991 polypeptide=Lus10018018 locus=Lus10018018.g ID=Lus10018018.BGIv1.0 annot-version=v1.0
ATGGCTTTGGTATCAGGAGGAAGATCAACTCTGAACCCGGATGCACCGCCATTCATTCCAGCTGCTTACAAGCAAGTAGAGGATTTCTCCCCGGAATGGT
GGCAGCTGGTTACAACCACAACATGGTACAAAGACTACTGGATCAGCCAGCATCAAAACGAGGAAGGTCTCTACAACGATGCACAAGTTCAAGATCATGA
TGATGGTGATCTTGACAGCAAAGATATAGCCGGGTTGCTGCCCGACACATTTGATCTTGATGTTGGGGCAGGGGTCGATTTCTCTGCTTTCGACGGTTTT
GTTGAATCGTACGAAGCTGAGGTGGAGAATAGAACAACACCTCATACTGTACCCTCCTATGGAAACAGTTATGCAAGTTATGCAAGTTATGCAATTGGAG
GAGGAGCTGTGGCTCCTCCGGCAGCAGCAGTAGTGAACCGAAGCTGA
AA sequence
>Lus10018018 pacid=23147991 polypeptide=Lus10018018 locus=Lus10018018.g ID=Lus10018018.BGIv1.0 annot-version=v1.0
MALVSGGRSTLNPDAPPFIPAAYKQVEDFSPEWWQLVTTTTWYKDYWISQHQNEEGLYNDAQVQDHDDGDLDSKDIAGLLPDTFDLDVGAGVDFSAFDGF
VESYEAEVENRTTPHTVPSYGNSYASYASYAIGGGAVAPPAAAVVNRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10018018 0 1
AT1G25275 unknown protein Lus10006792 2.0 0.8711
AT4G37420 Domain of unknown function (DU... Lus10016022 2.8 0.8238
AT2G46080 unknown protein Lus10036385 7.3 0.8684
AT4G17250 unknown protein Lus10008508 7.4 0.8430
AT5G07840 PIA1 phytochrome interacting ankyri... Lus10018958 9.8 0.8572
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10002228 13.7 0.8521
AT1G71840 transducin family protein / WD... Lus10033710 15.6 0.8015
AT2G27830 unknown protein Lus10009391 18.2 0.7764
AT1G22040 Galactose oxidase/kelch repeat... Lus10020960 18.7 0.8417
AT1G68660 Ribosomal protein L12/ ATP-dep... Lus10035041 18.8 0.8187

Lus10018018 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.