Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17615 62 / 3e-13 Disease resistance protein (TIR-NBS class) (.1) AT1G72900 61 / 9e-13 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G36930 61 / 1e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 59 / 3e-12 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT4G09430 59 / 5e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72940 59 / 8e-12 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72860 57 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72890 57 / 4e-11 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72910 55 / 2e-10 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72950 54 / 3e-10 Disease resistance protein (TIR-NBS class) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042020 [exp] 74 / 5e-17 AT1G72890 147 / 3e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10023272 [exp] 71 / 4e-16 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007790 [exp] 71 / 4e-16 AT5G36930 343 / 4e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10006929 [exp] 70 / 5e-16 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10006928 [exp] 71 / 7e-16 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10013729 [exp] 69 / 3e-15 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014671 [exp] 68 / 3e-15 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014829 [exp] 68 / 5e-15 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005374 [exp] 66 / 6e-15 AT1G17615 127 / 2e-35 Disease resistance protein (TIR-NBS class) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T002428 [exp] 71 / 4e-16 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 71 / 4e-16 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 69 / 1e-15 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T126706 [exp] 69 / 2e-15 AT3G14470 565 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.019G019710 [exp] 69 / 2e-15 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 69 / 2e-15 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 69 / 2e-15 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001971 [exp] 69 / 2e-15 AT5G36930 427 / 3e-130 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G070300 [exp] 69 / 2e-15 AT5G17680 558 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.007G143300 [exp] 69 / 2e-15 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10018023 pacid=23147987 polypeptide=Lus10018023 locus=Lus10018023.g ID=Lus10018023.BGIv1.0 annot-version=v1.0 ATGACGACAAACACATCACCTCCACATAACTACGGCGTATTCCTCAGCTTCAGAGGAGCCGACCTCCGCAACAAATTCGTTCACTACCTCTACTCCAGAC TTTGCCAGCTCAAGGTCCACACTTTCCTTGACGACATGATACTCCAGAAGGGCGAATCGGTCGTGGAATCCATGAACCTTGGCATCCAGCAGTCGAAAAT CTTCGTCGTCGTGTTCTCCTAG
AA sequence Show only first row Show all	>Lus10018023 pacid=23147987 polypeptide=Lus10018023 locus=Lus10018023.g ID=Lus10018023.BGIv1.0 annot-version=v1.0 MTTNTSPPHNYGVFLSFRGADLRNKFVHYLYSRLCQLKVHTFLDDMILQKGESVVESMNLGIQQSKIFVVVFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17615			Disease resistance protein (TI...		Lus10018023 [exp]	0	1
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10016168 [exp]	3.2	0.8054
AT4G16195			Plant self-incompatibility pro...		Lus10017929 [exp]	4.5	0.8054
					Lus10034545 [exp]	5.5	0.8054
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007059 [exp]	6.3	0.8054
AT5G67090			Subtilisin-like serine endopep...		Lus10002044 [exp]	7.1	0.8054
AT1G08790			Protein of unknown function (D...		Lus10042536 [exp]	8.1	0.7274
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Lus10022732 [exp]	9.4	0.6929
AT5G08020		ATRPA70B	ARABIDOPSIS THALIANA RPA70-KDA...		Lus10042979 [exp]	11.5	0.6484
					Lus10028981 [exp]	12.0	0.6342
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029379 [exp]	14.4	0.6654

Compare expression of checked genes

Lus10018023 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.