Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56710 159 / 6e-52 Ribosomal protein L31e family protein (.1.2) AT4G26230 159 / 8e-52 Ribosomal protein L31e family protein (.1) AT2G19740 159 / 9e-52 Ribosomal protein L31e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042028 [exp] 195 / 6e-66 AT2G19740 198 / 3e-67 Ribosomal protein L31e family protein (.1) Lus10025830 [exp] 192 / 5e-65 AT2G19740 200 / 5e-68 Ribosomal protein L31e family protein (.1) Lus10038272 [exp] 191 / 5e-60 AT2G19740 200 / 9e-63 Ribosomal protein L31e family protein (.1) Lus10015698 [exp] 160 / 7e-52 AT5G56710 201 / 2e-68 Ribosomal protein L31e family protein (.1.2) Lus10037703 [exp] 158 / 3e-51 AT5G56710 199 / 1e-67 Ribosomal protein L31e family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G070100 [exp] 167 / 7e-55 AT2G19740 170 / 6e-56 Ribosomal protein L31e family protein (.1) Potri.009G064100 [exp] 157 / 7e-51 AT2G19740 164 / 1e-53 Ribosomal protein L31e family protein (.1) Potri.001G269600 [exp] 154 / 9e-50 AT2G19740 162 / 5e-53 Ribosomal protein L31e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01198 [flax] [poplar] Ribosomal_L31e Ribosomal protein L31e
Representative CDS sequence Show only first row Show all	>Lus10018032 pacid=23147922 polypeptide=Lus10018032 locus=Lus10018032.g ID=Lus10018032.BGIv1.0 annot-version=v1.0 ATGGTTGAGAAGACTAGGATCAGGAAAGAGGAGGTGGTGACTAGGGAGTACACCATCAACCTTCACAAGCGGTTGCACGGATGCACCTTCAAGAAGAAGG CACCCAAGGCCATCAAGGAGATCAGGAAGTTTGCTGAGAAGGCTATGGGGACGAAGGATGTCAGAGTGGACGGGAAGCTGAACAAGCAAATTTTGAGCAA GGGTATCAGGAGTGTTCCAAGGAGAATCAGGGTTCGCATTGCACGTAAGAGGAACGATGATGAAGATGCAAAGGAGGAGCTCTATTCCCTTGTTACTGTT GCTGAGGCACCAGAAGGACTCAAGGGGTTGAGCACAAAGATTATCGAAGATGAAGAGTAA
AA sequence Show only first row Show all	>Lus10018032 pacid=23147922 polypeptide=Lus10018032 locus=Lus10018032.g ID=Lus10018032.BGIv1.0 annot-version=v1.0 MVEKTRIRKEEVVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDGKLNKQILSKGIRSVPRRIRVRIARKRNDDEDAKEELYSLVTV AEAPEGLKGLSTKIIEDEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G19740			Ribosomal protein L31e family ...		Lus10018032 [exp]	0	1
AT4G18100			Ribosomal protein L32e (.1)		Lus10031699 [exp]	1.4	0.9170
AT3G23620			Ribosomal RNA processing Brix ...		Lus10027714 [exp]	2.0	0.9057
AT3G54200			Late embryogenesis abundant (L...		Lus10040941 [exp]	2.2	0.8828
AT1G41880			Ribosomal protein L35Ae family...		Lus10040235 [exp]	3.0	0.8930
AT5G28060			Ribosomal protein S24e family ...		Lus10004123 [exp]	4.0	0.8862
AT3G11510			Ribosomal protein S11 family p...		Lus10014220 [exp]	5.5	0.8773
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10016431 [exp]	5.9	0.8752
AT1G76065			LYR family of Fe/S cluster bio...		Lus10005622 [exp]	6.6	0.7843
AT4G18100			Ribosomal protein L32e (.1)		Lus10004589 [exp]	6.7	0.8706
AT3G22660			rRNA processing protein-relate...		Lus10031120 [exp]	8.8	0.8659

Compare expression of checked genes

Lus10018032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.