Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21290 59 / 9e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042050 [exp] 91 / 1e-22 AT5G17990 501 / 6e-176 PHOSPHORIBOSYLANTHRANILATE TRANSFERASE 1, tryptophan biosynthesis 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G124700 [exp] 54 / 1e-10 AT2G21290 45 / 1e-07 unknown protein Potri.004G163100 [exp] 49 / 8e-09 AT2G21290 41 / 6e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018053 pacid=23147904 polypeptide=Lus10018053 locus=Lus10018053.g ID=Lus10018053.BGIv1.0 annot-version=v1.0 ATGGCGACGGCGATGCAGCGATGCGGCGGGGCTGCGAAACGGATTGTCATGGCGGCGACTCAGCAGCAGTCGTCGTCTTTCTCGTCACTGTCACCAGCTT CTTCATCAGCAGCATTAGGGTGCCCGATTCTGTGCGGTCGGGGTGACAAGAAGACGAAGAAAGGGAAGATATTTAAAGGCACGTACGGAAACTCGAGGCC AAAGAAGGAGAAGCAGATCGAGCGAATCAAGGACAAAAATGAGGTTCCCAGGTCCACTCCCTGGCCCCTCCCCTTCAAGCTCATCTGA
AA sequence Show only first row Show all	>Lus10018053 pacid=23147904 polypeptide=Lus10018053 locus=Lus10018053.g ID=Lus10018053.BGIv1.0 annot-version=v1.0 MATAMQRCGGAAKRIVMAATQQQSSSFSSLSPASSSAALGCPILCGRGDKKTKKGKIFKGTYGNSRPKKEKQIERIKDKNEVPRSTPWPLPFKLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21290			unknown protein		Lus10018053 [exp]	0	1
AT5G41685			Mitochondrial outer membrane t...		Lus10001641 [exp]	1.7	0.8160
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10043207 [exp]	3.6	0.8360
AT2G26110			Protein of unknown function (D...		Lus10026978 [exp]	3.7	0.7785
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10035034 [exp]	4.2	0.8234
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041513 [exp]	5.0	0.8017
AT3G21740		APO4	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10027182 [exp]	5.1	0.7487
AT4G25270		OTP70	organelle transcript processin...		Lus10031134 [exp]	6.3	0.8054
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10037505 [exp]	6.6	0.7828
AT1G30475			unknown protein		Lus10027131 [exp]	7.5	0.7847
AT2G20540		MEF21	mitochondrial editing factor ...		Lus10004663 [exp]	8.0	0.7382

Compare expression of checked genes

Lus10018053 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.