Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21250 514 / 0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 501 / 0 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37770 204 / 4e-64 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 204 / 9e-64 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 189 / 2e-58 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT3G53880 183 / 8e-56 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G62420 178 / 8e-54 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G01670 173 / 7e-52 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT1G59950 171 / 7e-51 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 171 / 7e-51 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042054 [exp] 598 / 0 AT2G21250 548 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 205 / 4e-64 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010885 [exp] 205 / 4e-64 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10031162 [exp] 199 / 1e-61 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010884 [exp] 196 / 1e-60 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10031739 [exp] 194 / 6e-60 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10021491 [exp] 192 / 2e-59 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10012652 [exp] 195 / 3e-59 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024354 [exp] 195 / 4e-58 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G125100 [exp] 536 / 0 AT2G21250 526 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 204 / 5e-64 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.006G090600 [exp] 199 / 7e-62 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102032 [exp] 195 / 2e-60 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 192 / 3e-59 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.001G125400 [exp] 187 / 3e-57 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.010G097800 [exp] 182 / 8e-55 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.008G193100 [exp] 180 / 1e-54 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G144600 [exp] 180 / 5e-54 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 178 / 6e-54 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10018058 pacid=23147964 polypeptide=Lus10018058 locus=Lus10018058.g ID=Lus10018058.BGIv1.0 annot-version=v1.0 ATGTCGGCAATCACACTGAACAATGGCTTGAAAATGCCTACACTCGGTTTGGGAGTCTGGCGAATGGAAGGGAAGGAGATTAGGGGCCTCATCCTTAACG CTATCAAGATCGGCTATCGCCATTTCGATTGTGCCGCTGATTATAAGAATGAAGCTGAAGTTGGGGAGGCACTTGCTGAAGCTTTCAAGACTGGACTTGT CAAAAGGGAGGATCTTTTCATTACTACTAAGCTTTGGAATTCGGATCACGGGCATGTTCTCGAGGCTTGCAAAGACAGTCTGAAGAAGCTTCAGCTTGAT TATCTGGATCTCTACCTTGTTCACTTTCCAGTTGCAACGAAGCATACTGGAGTTGGCATGACGTCTAGTGCTTTGGATGCCGAGGGGGTTCTGGAAATAG ACACAACCATAACTTTGGAAGCGACTTGGCATGACATGGAAGACCTGGTCTCCAAGGGTTTAGCTCGAAGCATTGGTATCAGCAACTATGACATCTTCCT AACCAGGGATTGCTTAGCCTACTCGAAAGTGAAGCCAGCTGTGAATCAAATCGAAACTCATCCTTACTTTCAGCGTGAATCTCTCGTAAAGTTCTGTCTA AAGCACGGCATTTCAGTGACCGCTCACACCCCTCTCGGAGGCTCTCTGGCTAATACTGAATGGTTCGGCTCAGTATCCTGCTTGGACGATACTATTCTCA AAAGTCTGGGTGAGAAGTACAAGAAGACAGCTGCTCAAATCGCTCTGAGGTGGGGGATTCAAAGAGAAACGGTTGTCATCCCGAAATCTTCAAAGGTTGA GAGGCTGAAAGAGAATTTTGAAGTTTTTGACTTCGAGCTGACCAAAGAGGACATGGAGCTGATCAAAGGAATGGACAGGAAGTACAGAACCAACCAACCT GCCAAGTTCTGGGGGGTCGATCTCTATGCGTAG
AA sequence Show only first row Show all	>Lus10018058 pacid=23147964 polypeptide=Lus10018058 locus=Lus10018058.g ID=Lus10018058.BGIv1.0 annot-version=v1.0 MSAITLNNGLKMPTLGLGVWRMEGKEIRGLILNAIKIGYRHFDCAADYKNEAEVGEALAEAFKTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKLQLD YLDLYLVHFPVATKHTGVGMTSSALDAEGVLEIDTTITLEATWHDMEDLVSKGLARSIGISNYDIFLTRDCLAYSKVKPAVNQIETHPYFQRESLVKFCL KHGISVTAHTPLGGSLANTEWFGSVSCLDDTILKSLGEKYKKTAAQIALRWGIQRETVVIPKSSKVERLKENFEVFDFELTKEDMELIKGMDRKYRTNQP AKFWGVDLYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21250			NAD(P)-linked oxidoreductase s...		Lus10018058 [exp]	0	1
AT4G25050		ACP4	acyl carrier protein 4 (.1.2)		Lus10037908 [exp]	2.6	0.8077
AT1G67785			unknown protein		Lus10018082 [exp]	3.6	0.7369
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10000050 [exp]	4.9	0.7763
AT4G23330			unknown protein		Lus10024630 [exp]	8.1	0.7236
AT2G02850		ARPN	plantacyanin (.1)		Lus10018938 [exp]	8.5	0.7630
AT5G38790			unknown protein		Lus10034101 [exp]	8.7	0.7841
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10032281 [exp]	9.5	0.7350
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Lus10013785 [exp]	9.8	0.7389
AT3G07470			Protein of unknown function, D...		Lus10025861 [exp]	15.5	0.7163
AT5G45390		NCLPP3, NCLPP4,...	NUCLEAR-ENCODED CLP PROTEASE P...		Lus10012156 [exp]	16.4	0.7415

Compare expression of checked genes

Lus10018058 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.