Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01130 41 / 9e-07 unknown protein AT5G15320 40 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042059 [exp] 48 / 7e-09 AT3G01130 58 / 2e-12 unknown protein Lus10033166 [exp] 38 / 7e-05 AT5G39600 207 / 1e-67 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G125832 [exp] 43 / 1e-07 AT3G01130 55 / 2e-12 unknown protein Potri.004G164066 [exp] 43 / 1e-07 AT3G01130 55 / 2e-12 unknown protein Potri.002G024900 [exp] 39 / 6e-06 AT5G15320 76 / 1e-20 unknown protein Potri.005G236500 [exp] 37 / 4e-05 AT5G15320 36 / 9e-05 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05680 [flax] [poplar] ATP-synt_E ATP synthase E chain
Representative CDS sequence Show only first row Show all	>Lus10018064 pacid=23147917 polypeptide=Lus10018064 locus=Lus10018064.g ID=Lus10018064.BGIv1.0 annot-version=v1.0 ATGCCGCCTCCTCCTCCTGGACCTTACTCCGGCACCAGCACTCTTGCTCTGGTGGCTCGTGTAGCGGCGTTTTCCACTGGTCTCGTCTATGGCAACTTGA AGCTCAAGTACCTCAAGGCAAAGGCCAAATCGCATAAGAAAGCTGAAGCAAAGGCTCAACACTAA
AA sequence Show only first row Show all	>Lus10018064 pacid=23147917 polypeptide=Lus10018064 locus=Lus10018064.g ID=Lus10018064.BGIv1.0 annot-version=v1.0 MPPPPPGPYSGTSTLALVARVAAFSTGLVYGNLKLKYLKAKAKSHKKAEAKAQH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15320			unknown protein		Lus10018064 [exp]	0	1
AT4G05390		ATRFNR1	root FNR 1 (.1.2)		Lus10023266 [exp]	2.2	0.9664
AT4G05390		ATRFNR1	root FNR 1 (.1.2)		Lus10038538 [exp]	3.7	0.9575
AT2G26170		CYP711A1, MAX1	MORE AXILLARY BRANCHES 1, "cyt...		Lus10013133 [exp]	4.8	0.9355
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10001906 [exp]	6.5	0.9360
AT1G28120			unknown protein		Lus10026630 [exp]	7.1	0.9486
AT2G01140		PDE345	PIGMENT DEFECTIVE 345, Aldolas...		Lus10034619 [exp]	7.7	0.9487
AT3G63010		ATGID1B, GID1B	GA INSENSITIVE DWARF1B, alpha/...		Lus10008188 [exp]	8.1	0.9492
AT1G65930		cICDH	cytosolic NADP+-dependent isoc...		Lus10020798 [exp]	8.5	0.9479
AT1G11300			protein serine/threonine kinas...		Lus10039731 [exp]	8.5	0.9452
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Lus10037283 [exp]	8.7	0.9342

Compare expression of checked genes

Lus10018064 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.