Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67785 101 / 2e-30 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042077 [exp] 77 / 1e-20 AT1G67785 67 / 4e-17 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G087301 [exp] 102 / 6e-31 AT1G67785 90 / 5e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018082 pacid=23147860 polypeptide=Lus10018082 locus=Lus10018082.g ID=Lus10018082.BGIv1.0 annot-version=v1.0 ATGGTGAAGGTCTCAACTTACTTCGCGATGACATTGGGCGCCTTTGTGTTTTGGCAATCGATGGATAAGCTTCATGTCTGGATCGCTCTTCACCAGGATG AAAAGCAAGAACGGATCGAAAAGGAAATGGAGATCAAGAGGGTTAGAGAAGAGCTGCTTCAACAAGCTAAAGAAAGGGACACTATTGGTTGA
AA sequence Show only first row Show all	>Lus10018082 pacid=23147860 polypeptide=Lus10018082 locus=Lus10018082.g ID=Lus10018082.BGIv1.0 annot-version=v1.0 MVKVSTYFAMTLGAFVFWQSMDKLHVWIALHQDEKQERIEKEMEIKRVREELLQQAKERDTIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67785			unknown protein		Lus10018082 [exp]	0	1
AT2G21250			NAD(P)-linked oxidoreductase s...		Lus10018058 [exp]	3.6	0.7369
AT5G36230			ARM repeat superfamily protein...		Lus10042703 [exp]	10.6	0.7064
AT1G07210			Ribosomal protein S18 (.1)		Lus10039100 [exp]	12.0	0.6468
AT3G62810			complex 1 family protein / LVR...		Lus10040570 [exp]	16.6	0.6751
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10000050 [exp]	17.9	0.6956
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10039077 [exp]	19.6	0.6463
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Lus10013785 [exp]	23.2	0.6581
AT4G21720			unknown protein		Lus10017512 [exp]	24.4	0.6692
AT3G57930			unknown protein		Lus10031233 [exp]	27.5	0.6427
AT5G09920		NRPB4, ATRPB15....	RNA polymerase II, Rpb4, core ...		Lus10005796 [exp]	29.5	0.6602

Compare expression of checked genes

Lus10018082 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.