Lus10018086 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50280 337 / 1e-110 EMB1006 embryo defective 1006, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05670 117 / 6e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G62720 115 / 7e-29 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G11690 115 / 2e-28 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G31850 114 / 6e-28 PGR3 proton gradient regulation 3 (.1)
AT5G65560 114 / 1e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G31400 112 / 3e-27 GUN1 genomes uncoupled 1 (.1)
AT1G63070 111 / 5e-27 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G39710 111 / 8e-27 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12775 110 / 9e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042081 646 / 0 AT5G50280 648 / 0.0 embryo defective 1006, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042529 114 / 6e-28 AT5G65560 498 / 1e-160 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016009 110 / 1e-26 AT5G42310 921 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10015530 108 / 7e-26 AT2G18940 1010 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000909 107 / 1e-25 AT1G74580 270 / 3e-79 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012268 107 / 2e-25 AT5G42310 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10023650 107 / 2e-25 AT5G21222 623 / 0.0 protein kinase family protein (.1)
Lus10033127 106 / 5e-25 AT1G74850 1179 / 0.0 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1)
Lus10021989 105 / 6e-25 AT5G65560 498 / 2e-157 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G091800 363 / 6e-121 AT5G50280 845 / 0.0 embryo defective 1006, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.019G021200 123 / 3e-31 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.014G090400 121 / 2e-30 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G034200 115 / 2e-28 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G242500 115 / 2e-28 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G010900 115 / 3e-28 AT5G42310 939 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.006G271400 113 / 1e-27 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.009G092100 113 / 2e-27 AT5G02860 1146 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G242200 112 / 2e-27 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G250200 112 / 2e-27 AT5G42310 974 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10018086 pacid=23147951 polypeptide=Lus10018086 locus=Lus10018086.g ID=Lus10018086.BGIv1.0 annot-version=v1.0
ATGAGTTGCTTGTACTTCTACGAATGGATGAGTACGCAGGATCCGCCTGCTATCACGCCTCGAGCTCCCACTGTTCTCTTCCCCTTACTCGGCAAGGCTG
GATTGGGTGATGAAATGATGTCTCTCTTCCAAAAATTGCCCCGGAACGATGAATTCAGAGACGGCCATGTCTTCAATGCTGCTATGTCCGGCTTTCTCTA
CTGCGGCAGGTATGACGATGCACGCAAGGTGAACGAGAAAATGCCAGAAACCGATATCCATCCTAGTCACGTCACTTGTTCGATAATGATGTCTGTAATG
AAAAAGCAAGGCCGTTTCCAGAAGGAAGCGTCGGATTTCTTTCGGACGACGTTCAGGAATGGAGTCGTATGGAATTCCGGAAGCCTCATCGGCTTAATCA
AATCGCTCTGCGATGCCGGTCTGAAGGAGCAAGCCGCCAGGATCCTATCCGAAATTGTGAAGGAAGGAGAAGCTGCTCCTCACGTGGTCGTGTACGACGT
GTTAATCAAAGCTTATTTCAACTCCGACCGAGCTGGAAAAGCCGAAGCTCTGTTCGCCGAGATGAAGGCACTAGGCGTTGAGCCAACGACTGCAACTTAC
AACTTGCTTATGAATGCATACAGCGTAAGGATGCAGCCCGAAATGGTTGAGAAGCTGCTTAAAGAGATGCAGGATCGAGGTTTGAAACAGAATCCTAAAT
CATTTACGTCGTTAATTCGTGCATATGGGAGCCAGAAGAAGTGCGAATTGGCTGCGGATGCATTCTTGAGAATGAAGAGACTAGGCGTTGAACCTCATGC
GCATAACTACTGTGCTCTCATCCATGCTTATTCGGCCAGCGGGCAGTATGAGCAGGCTTATGCAGTGTTTGAAGATATGCAGCTTGAAGGAGTAATCCCT
AGTTCGGATACTTACACAGCATTGCTGGATGCGATCAGGCATGCCGGTGACACTGATAAGTTGATGAAGATATGA
AA sequence
>Lus10018086 pacid=23147951 polypeptide=Lus10018086 locus=Lus10018086.g ID=Lus10018086.BGIv1.0 annot-version=v1.0
MSCLYFYEWMSTQDPPAITPRAPTVLFPLLGKAGLGDEMMSLFQKLPRNDEFRDGHVFNAAMSGFLYCGRYDDARKVNEKMPETDIHPSHVTCSIMMSVM
KKQGRFQKEASDFFRTTFRNGVVWNSGSLIGLIKSLCDAGLKEQAARILSEIVKEGEAAPHVVVYDVLIKAYFNSDRAGKAEALFAEMKALGVEPTTATY
NLLMNAYSVRMQPEMVEKLLKEMQDRGLKQNPKSFTSLIRAYGSQKKCELAADAFLRMKRLGVEPHAHNYCALIHAYSASGQYEQAYAVFEDMQLEGVIP
SSDTYTALLDAIRHAGDTDKLMKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G50280 EMB1006 embryo defective 1006, Pentatr... Lus10018086 0 1
AT4G39010 ATGH9B18 glycosyl hydrolase 9B18 (.1) Lus10035475 3.2 0.8570
AT1G09900 Pentatricopeptide repeat (PPR-... Lus10031564 5.7 0.8768
AT4G02790 EMB3129 EMBRYO DEFECTIVE 3129, GTP-bin... Lus10006927 8.2 0.8627
AT5G15710 Galactose oxidase/kelch repeat... Lus10035147 12.1 0.8046
AT2G20830 transferases;folic acid bindin... Lus10018557 12.6 0.7946
Lus10040408 15.4 0.7815
AT4G02790 EMB3129 EMBRYO DEFECTIVE 3129, GTP-bin... Lus10014672 16.4 0.8739
AT2G23180 CYP96A1 "cytochrome P450, family 96, s... Lus10022279 16.5 0.8337
AT4G37380 Tetratricopeptide repeat (TPR)... Lus10010385 16.8 0.8715
AT4G30825 Tetratricopeptide repeat (TPR)... Lus10036601 20.1 0.8530

Lus10018086 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.