Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31305 81 / 4e-21 INH3 inhibitor-3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022410 [exp] 106 / 9e-29 AT2G31305 104 / 1e-27 inhibitor-3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G101900 [exp] 83 / 9e-22 AT2G31305 68 / 5e-16 inhibitor-3 (.1) Potri.005G067400 [exp] 80 / 8e-21 AT2G31305 66 / 4e-15 inhibitor-3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07491 [flax] [poplar] PPI_Ypi1 Protein phosphatase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10018105 pacid=23145175 polypeptide=Lus10018105 locus=Lus10018105.g ID=Lus10018105.BGIv1.0 annot-version=v1.0 ATGAGACGAACAGCCACTTCATCTGCGGCGTCTTCCTCCGGAGCAACGTCCACCGAAACCATAGTCCTTGACAACCCATCCCAGCGTCAACAGCAACCCC CACCGCAAACCCTAGTTCTGCGGCTGAGTCGGCCGAAGAAGAAGGTTTCTTGGAAAGAAGGTACGGTAGACAACGAATTCATGCAGAAGAAGAGCTCTAA GAAGTGCTGCATCTTCCACAAGCAGAAGCCCTTTGACGAAGACGACAGCGACGAAGATGAAAATCATGATCCGGATCATCATCATCACGATCATCCTTCT GATAACTGCTGTTCTTCCAATGACGGCCGCTGTGGTTGA
AA sequence Show only first row Show all	>Lus10018105 pacid=23145175 polypeptide=Lus10018105 locus=Lus10018105.g ID=Lus10018105.BGIv1.0 annot-version=v1.0 MRRTATSSAASSSGATSTETIVLDNPSQRQQQPPPQTLVLRLSRPKKKVSWKEGTVDNEFMQKKSSKKCCIFHKQKPFDEDDSDEDENHDPDHHHHDHPS DNCCSSNDGRCG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31305		INH3	inhibitor-3 (.1)		Lus10018105 [exp]	0	1
AT5G42000			ORMDL family protein (.1.2)		Lus10003209 [exp]	1.4	0.7941
AT4G08455			BTB/POZ domain-containing prot...		Lus10042763 [exp]	13.2	0.6965
AT1G13950		EIF5A, ATELF5A-...	eukaryotic elongation factor 5...		Lus10036801 [exp]	14.7	0.6892
AT4G25225			unknown protein		Lus10038922 [exp]	18.3	0.6839
AT1G24620			EF hand calcium-binding protei...		Lus10004330 [exp]	24.2	0.7056
AT5G11090			serine-rich protein-related (....		Lus10001928 [exp]	26.4	0.6924
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Lus10018222 [exp]	49.9	0.6272
AT3G60450			Phosphoglycerate mutase family...		Lus10024765 [exp]	53.0	0.6426
AT1G68070			Zinc finger, C3HC4 type (RING ...		Lus10021801 [exp]	53.5	0.6666
AT5G25280			serine-rich protein-related (....		Lus10008808 [exp]	56.5	0.6172

Compare expression of checked genes

Lus10018105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.