Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24280 47 / 5e-07 GMI1 gamma-irradiation and mitomycin c induced 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022400 [exp] 175 / 5e-52 AT5G24280 1270 / 0.0 gamma-irradiation and mitomycin c induced 1 (.1) Lus10023253 [exp] 46 / 1e-06 AT3G49250 359 / 7e-122 INVOLVED IN DE NOVO 1, defective in meristem silencing 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G016000 [exp] 43 / 1e-05 AT3G49250 426 / 8e-148 INVOLVED IN DE NOVO 1, defective in meristem silencing 3 (.1) Potri.012G016100 [exp] 38 / 0.0005 AT5G24280 1107 / 0.0 gamma-irradiation and mitomycin c induced 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018114 pacid=23145267 polypeptide=Lus10018114 locus=Lus10018114.g ID=Lus10018114.BGIv1.0 annot-version=v1.0 ATGGAAGATTTGTGCCCTCAAGGGAGGCTGAAACTAGATCCGCCTATGATGCCTAATGGGGAACCGAGACCTGGTTTCGTAGGGGAGCATCAGCATATTG AAGGTGCTGTCTCTTTGGATGGCGGGATATTAAGAGCAGATGGAGTGGCTTCTCTTGGACAAAGGGAGCCATCGATTTGCTTCCCAGTAGTAAGTTCAAG ACGTGATGAGACGTGCTTAAGGATAGCGAAACATGTGCGTGGTTTGAAGGCCAAGCTGGAAGAGAATGCGAGAGAGATGGAGGCTTTCACGGAACAGCAT GCCAAAGCTGTAAGAAGCAAACCGAGAGGAAGTTGA
AA sequence Show only first row Show all	>Lus10018114 pacid=23145267 polypeptide=Lus10018114 locus=Lus10018114.g ID=Lus10018114.BGIv1.0 annot-version=v1.0 MEDLCPQGRLKLDPPMMPNGEPRPGFVGEHQHIEGAVSLDGGILRADGVASLGQREPSICFPVVSSRRDETCLRIAKHVRGLKAKLEENAREMEAFTEQH AKAVRSKPRGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018114 [exp]	0	1
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007067 [exp]	1.4	0.8215
					Lus10008926 [exp]	3.0	0.7746
					Lus10012543 [exp]	12.4	0.7209
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10019783 [exp]	17.4	0.8110
					Lus10040143 [exp]	17.7	0.7660
					Lus10004634 [exp]	21.6	0.8101
AT3G05950			RmlC-like cupins superfamily p...		Lus10038456 [exp]	24.5	0.8098
					Lus10035428 [exp]	26.5	0.7143
AT1G31670			Copper amine oxidase family pr...		Lus10010539 [exp]	27.5	0.8057
AT2G45650	MADS	AGL6	AGAMOUS-like 6 (.1)		Lus10015017 [exp]	27.6	0.7909

Compare expression of checked genes

Lus10018114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.