Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29140 115 / 8e-33 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 109 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 106 / 2e-29 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 99 / 1e-26 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 81 / 1e-19 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 65 / 1e-13 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G41050 43 / 2e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 43 / 3e-05 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 42 / 5e-05 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017940 [exp] 304 / 2e-107 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 298 / 9e-105 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 208 / 1e-69 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 207 / 6e-69 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 105 / 6e-29 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 103 / 2e-28 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 108 / 4e-28 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10042201 [exp] 101 / 1e-27 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 80 / 3e-19 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G111300 [exp] 170 / 2e-54 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 157 / 2e-49 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 102 / 4e-28 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 100 / 3e-27 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 99 / 1e-26 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 97 / 8e-26 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 50 / 2e-07 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.010G185400 [exp] 44 / 9e-06 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 43 / 4e-05 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 43 / 5e-05 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10018131 pacid=23145231 polypeptide=Lus10018131 locus=Lus10018131.g ID=Lus10018131.BGIv1.0 annot-version=v1.0 ATGGCAAAGACAGCAGTAGTCACCGTCACCGCCTTTGCCCTCTTCCTCCTCGCCGCCACTTCCGCCACCGCCGCCGTCCAGAAGATGTTCGTGGAGGGCA AGGTTTACTGCGATCCTTGCCGTGTTGAGTTCCCTGTTGAAATCAGTACCTTTCTGCCAGGAGCGAAGGTGAACTTGCAATGTAGATGCAGGGAGAACAG GACAATAACGTACGAGGTGCAGGGAGAGACAGACAATACAGGGAGGTACAGGCTACCGGTGGTTGCGGACCACGAGGAGGACTTTTGCCAGGTGAAGCTG TTGGGGAGCCCCGAGGCGGACTGCAATGAGCAATTCAAGTTCATAGACCGAGCCATGGTGGAGCTCACTGACAACATGGGCATGGCTCAGTCGACCCGCT ACGCCAACGATATTGGCTACATGAAGTCCACTACTGACCCTCGTTGCGCGAAGATCTTGCAAGACATGGGACTGAACCTTCATGAAGAACAGACCAGGTT CTTGAATTTGATTAAACATTGA
AA sequence Show only first row Show all	>Lus10018131 pacid=23145231 polypeptide=Lus10018131 locus=Lus10018131.g ID=Lus10018131.BGIv1.0 annot-version=v1.0 MAKTAVVTVTAFALFLLAATSATAAVQKMFVEGKVYCDPCRVEFPVEISTFLPGAKVNLQCRCRENRTITYEVQGETDNTGRYRLPVVADHEEDFCQVKL LGSPEADCNEQFKFIDRAMVELTDNMGMAQSTRYANDIGYMKSTTDPRCAKILQDMGLNLHEEQTRFLNLIKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29140			Pollen Ole e 1 allergen and ex...		Lus10018131 [exp]	0	1
AT5G26330			Cupredoxin superfamily protein...		Lus10006680 [exp]	5.9	1.0000
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10006721 [exp]	6.2	1.0000
AT2G40070			unknown protein		Lus10008717 [exp]	8.3	1.0000
					Lus10010414 [exp]	9.4	1.0000
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10010628 [exp]	10.5	1.0000
					Lus10010663 [exp]	10.7	1.0000
					Lus10014229 [exp]	12.3	1.0000
AT2G39518			Uncharacterised protein family...		Lus10031304 [exp]	13.1	1.0000
AT4G03230			S-locus lectin protein kinase ...		Lus10031602 [exp]	13.8	1.0000
AT5G64820			unknown protein		Lus10025572 [exp]	15.7	1.0000

Compare expression of checked genes

Lus10018131 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.