Lus10018139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49910 203 / 3e-68 Translation protein SH3-like family protein (.1)
AT5G67510 198 / 2e-66 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028537 226 / 2e-77 AT3G49910 262 / 1e-91 Translation protein SH3-like family protein (.1)
Lus10019283 169 / 4e-55 AT3G49910 212 / 1e-72 Translation protein SH3-like family protein (.1)
Lus10011540 130 / 2e-40 AT3G49910 178 / 3e-59 Translation protein SH3-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G085200 211 / 1e-71 AT3G49910 241 / 3e-83 Translation protein SH3-like family protein (.1)
Potri.007G055900 208 / 2e-70 AT3G49910 236 / 2e-81 Translation protein SH3-like family protein (.1)
Potri.005G082600 184 / 1e-60 AT3G49910 214 / 2e-72 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Lus10018139 pacid=23145170 polypeptide=Lus10018139 locus=Lus10018139.g ID=Lus10018139.BGIv1.0 annot-version=v1.0
ATGAAGTACAATCCTAGGGTTTCCTCCTCCCGCCGCAAGAACCGCAAGGCGCACTTCACCGCCCCGTCGTCGGTCCGCCGCGTCCTGATGAGCGCTCCGC
TCTCCACCGACCTCCGCCAGAAGTACAACGTGAGGTCCATGCCGGTTCGCAAGGACGACGAGGTCCAGGTCGTCAGGGGAACCTTCAAGGGGCGCGAGGG
GAAAGTGGTCCAGGTGTACCGCCGGAAGTGGGTCATTCACATCGAGCGCATCACAAGGGAGAAGGTGAACGGATCCACCGTCAACGTCGGAGTCCACCCT
TCGAAGGTCGTCGTCACCAAGCTCCGCCTCGACAAGGATCGCAAGTCTCTGCTCGACCGGAAGGCCAAAGGACGCGCTGCTGCTGACAAGGAAAAGGGTA
CCGCTGATGATATCATGCAGAATGTTGATTGA
AA sequence
>Lus10018139 pacid=23145170 polypeptide=Lus10018139 locus=Lus10018139.g ID=Lus10018139.BGIv1.0 annot-version=v1.0
MKYNPRVSSSRRKNRKAHFTAPSSVRRVLMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTFKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGVHP
SKVVVTKLRLDKDRKSLLDRKAKGRAAADKEKGTADDIMQNVD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49910 Translation protein SH3-like f... Lus10018139 0 1
AT5G52370 unknown protein Lus10040713 2.6 0.9636
AT5G48760 Ribosomal protein L13 family p... Lus10032599 2.6 0.9732
AT3G04770 RPSAB 40s ribosomal protein SA B (.1... Lus10037445 2.8 0.9711
AT4G29830 VIP3 vernalization independence 3, ... Lus10017159 4.0 0.9683
AT5G43970 ATTOM22-V, TOM2... TRANSLOCASE OUTER MITOCHONDRIA... Lus10024950 4.0 0.9563
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10035211 4.2 0.9638
AT3G57490 Ribosomal protein S5 family pr... Lus10027358 4.9 0.9701
AT3G11400 ATEIF3G1, EIF3G... eukaryotic translation initiat... Lus10030482 5.1 0.9592
AT3G49910 Translation protein SH3-like f... Lus10019283 5.5 0.9564
AT3G15000 cobalt ion binding (.1) Lus10043130 7.3 0.9482

Lus10018139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.