Lus10018141 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002999 95 / 1e-25 ND /
Lus10000455 70 / 4e-15 ND /
Lus10038003 60 / 1e-11 ND /
Lus10026451 52 / 3e-09 ND /
Lus10022081 49 / 4e-07 AT1G20960 218 / 1e-68 embryo defective 1507, U5 small nuclear ribonucleoprotein helicase, putative (.1.2)
Lus10005408 46 / 2e-06 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10018141 pacid=23145256 polypeptide=Lus10018141 locus=Lus10018141.g ID=Lus10018141.BGIv1.0 annot-version=v1.0
ATGAAGAAGTGTCTCTGGAGGTCGAAGCTCGCAATGTTCTCATTGATGTCATGCCCCGGCGGCACTAACAATATAACACCCAACTGGTTTCGAAAAAAAA
ACAAGCCTCAATCGAGTTGGAAATCAAACCATCACTCGAGCAAACTCAAGAGCTTTAGTCGAGCTGGTAACCGAGCCTTAAACGAGCTGGTTTGCGAGCC
AAACTCATTGAACTCACTAGACGAGCAGTCTCGAGAGCCAAGCTCCGCCGCGCCAAGGTTAGCTCGAACCCGACTTGATGGAATCCACCTCACGGTTCCA
GGCCATGGAGCTCGGAGTCCAAAGGCTCAAGAAATTGGAAAGAAGATCGATGAGAAGTTTGAAGGACTCGGAGAAGTTAGGAGCAAAAGCGACACATTCG
GGAGTCGAATCGGACCAGTTGGAGCCAAAGGCACGTTGGAATGGATCAATGATGACAAGTTCAGCCTCGAATAA
AA sequence
>Lus10018141 pacid=23145256 polypeptide=Lus10018141 locus=Lus10018141.g ID=Lus10018141.BGIv1.0 annot-version=v1.0
MKKCLWRSKLAMFSLMSCPGGTNNITPNWFRKKNKPQSSWKSNHHSSKLKSFSRAGNRALNELVCEPNSLNSLDEQSREPSSAAPRLARTRLDGIHLTVP
GHGARSPKAQEIGKKIDEKFEGLGEVRSKSDTFGSRIGPVGAKGTLEWINDDKFSLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018141 0 1
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 5.5 1.0000
AT2G15220 Plant basic secretory protein ... Lus10001608 7.7 1.0000
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 9.5 1.0000
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10009630 9.6 1.0000
Lus10011605 10.7 1.0000
Lus10025268 12.7 1.0000
Lus10024141 13.4 1.0000
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026232 13.6 1.0000
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 16.4 1.0000
Lus10013255 17.3 1.0000

Lus10018141 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.