Lus10018143 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13200 72 / 4e-16 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022566 84 / 6e-21 AT3G13200 307 / 1e-106 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
Lus10016651 84 / 1e-20 AT3G13200 311 / 3e-108 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G370366 71 / 5e-16 AT3G13200 247 / 6e-83 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04889 Cwf_Cwc_15 Cwf15/Cwc15 cell cycle control protein
Representative CDS sequence
>Lus10018143 pacid=23145183 polypeptide=Lus10018143 locus=Lus10018143.g ID=Lus10018143.BGIv1.0 annot-version=v1.0
ATGAACAATCAGGTGGTTCTCAATCAGCAAGGGACCTTGCTGCTCATACTACTCTCAAGTCAAGGAGTGAAGGCCAAGACACACAAGATGAACTCGAGAA
ACGCGATGAAAGTGATGATGATGAAGACGAAGACGAAGAAGAAGCTCTGTTGGTGGCTGAGCTCCGACGTGCAGTACAAGAAGGGCTTCTGCGTGATGAT
GAACAACAACTACAACCCAACATCCTTCGGTTTGAAGAGGAAGTGGGATGATGACGTTGTTTTCAAGAACCAGACGAGCGGCGAATCGAAAAGACAGAAA
CTTTTCGTCAACAACAACACTATCAGGAATGTTTTCCATCGTAGATTGTTGCAGAAGTACATGATATAG
AA sequence
>Lus10018143 pacid=23145183 polypeptide=Lus10018143 locus=Lus10018143.g ID=Lus10018143.BGIv1.0 annot-version=v1.0
MNNQVVLNQQGTLLLILLSSQGVKAKTHKMNSRNAMKVMMMKTKTKKKLCWWLSSDVQYKKGFCVMMNNNYNPTSFGLKRKWDDDVVFKNQTSGESKRQK
LFVNNNTIRNVFHRRLLQKYMI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Lus10018143 0 1
AT4G36670 AtPMT6, AtPLT6 polyol/monosaccharide transpor... Lus10026032 2.8 0.8576
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10004906 3.5 0.8674
AT5G43500 ATARP9 actin-related protein 9 (.1.2) Lus10021206 14.1 0.8295
AT2G24840 MADS DIA, AGL61 DIANA, AGAMOUS-like 61 (.1) Lus10030663 21.8 0.8274
AT5G46030 unknown protein Lus10014995 21.8 0.8209
Lus10019466 22.6 0.7515
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10006119 26.7 0.8427
AT2G15220 Plant basic secretory protein ... Lus10019805 27.9 0.7086
AT3G11660 NHL1 NDR1/HIN1-like 1 (.1) Lus10013327 28.4 0.8180
AT5G12890 UDP-Glycosyltransferase superf... Lus10025514 31.5 0.7563

Lus10018143 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.