Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39480 114 / 3e-29 CYP96A9 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) AT4G39490 112 / 7e-29 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT2G23180 107 / 5e-27 CYP96A1 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) AT1G57750 107 / 5e-27 MAH1, CYP96A15 MID-CHAIN ALKANE HYDROXYLASE 1, "cytochrome P450, family 96, subfamily A, polypeptide 15", cytochrome P450, family 96, subfamily A, polypeptide 15 (.1.2) AT4G39510 107 / 6e-27 CYP96A12 "cytochrome P450, family 96, subfamily A, polypeptide 12", cytochrome P450, family 96, subfamily A, polypeptide 12 (.1) AT2G21910 107 / 1e-26 CYP96A5 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) AT4G32170 105 / 4e-26 CYP96A2 "cytochrome P450, family 96, subfamily A, polypeptide 2", cytochrome P450, family 96, subfamily A, polypeptide 2 (.1) AT5G52320 104 / 5e-26 CYP96A4 "cytochrome P450, family 96, subfamily A, polypeptide 4", cytochrome P450, family 96, subfamily A, polypeptide 4 (.1) AT1G63710 101 / 1e-24 CYP86A7 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) AT1G65340 96 / 5e-23 CYP96A3 "cytochrome P450, family 96, subfamily A, polypeptide 3", cytochrome P450, family 96, subfamily A, polypeptide 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025678 [exp] 303 / 2e-101 AT4G39490 363 / 9e-121 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10028047 [exp] 300 / 2e-100 AT2G21910 375 / 1e-125 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) Lus10015306 [exp] 288 / 3e-92 AT4G39490 342 / 3e-108 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10025677 [exp] 225 / 4e-71 AT2G23180 361 / 1e-119 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10018162 [exp] 191 / 6e-61 AT4G39490 113 / 7e-29 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10022279 [exp] 142 / 2e-39 AT2G23180 449 / 4e-154 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10003669 [exp] 135 / 8e-37 AT2G23180 440 / 4e-150 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10002527 [exp] 132 / 4e-36 AT2G23180 454 / 7e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10022277 [exp] 118 / 1e-30 AT4G39490 395 / 1e-132 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G397900 [exp] 149 / 5e-42 AT4G39490 480 / 6e-166 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.005G064400 [exp] 132 / 8e-36 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G086900 [exp] 129 / 1e-34 AT2G23180 455 / 2e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.015G087000 [exp] 118 / 4e-31 AT2G23180 373 / 2e-125 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.015G132800 [exp] 114 / 1e-29 AT4G39490 589 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.007G080300 [exp] 113 / 6e-29 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.007G072100 [exp] 97 / 3e-23 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.003G129100 [exp] 96 / 8e-23 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Potri.014G085800 [exp] 94 / 4e-22 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.005G092200 [exp] 92 / 2e-21 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018157 pacid=23145240 polypeptide=Lus10018157 locus=Lus10018157.g ID=Lus10018157.BGIv1.0 annot-version=v1.0 ATGGCGGCACGTGTTCTCCTACTCCTCGCACTCCTCACAGCCACTCTGGTTTACATCGTCGGCAGCGGCAAGTACAAAGAACTCAAGCTAATGTACGACA TCCTCCGCCGCCCATCCGAGCTCCACCGCACCGTCACCGACCGCCTCAAGTCGTGTGGCGGCACGGACCACACCACTTATCTGCTCCTCACCTGCGATCC CAGAAACATAGACCACATTTTCAACAAGCGCCACTCCAACTTCTCGAAAGGACCCAGGTTCCAAGACAAGCTCGAGTCGTTGGGGGAATGCATCTTCGCT GCCGATGGCGAATCGGGCCTCTCCCAGCGCCGGATCCTTCACTCCATCTCCAATTCTGCACCGTTTGAACGGCTTCTCGAAACTTCCCCCCTCGAAAAGC TCGAATCCGGCCTCTTCCCCGTCCTGGATTCTAGATCCACTAACCGGTTGGTGGAGCTAGACATGCAGGACGTGTACAAGAGGTTCATGTTCGACATTTT TTGCTCTGTTGTGCTCGGATTCGACCCCAACTATCTCACTGTCGAGCTGCTCCCTGATACCTTGTACGCCAAGGCTTACAAGTACTTGGAGGAGGTGACG TTTTACCGGTATGTCAGGCAGGATTTCTGGTGGAAATTTCAGAGATGGCGTTCAACATGA
AA sequence Show only first row Show all	>Lus10018157 pacid=23145240 polypeptide=Lus10018157 locus=Lus10018157.g ID=Lus10018157.BGIv1.0 annot-version=v1.0 MAARVLLLLALLTATLVYIVGSGKYKELKLMYDILRRPSELHRTVTDRLKSCGGTDHTTYLLLTCDPRNIDHIFNKRHSNFSKGPRFQDKLESLGECIFA ADGESGLSQRRILHSISNSAPFERLLETSPLEKLESGLFPVLDSRSTNRLVELDMQDVYKRFMFDIFCSVVLGFDPNYLTVELLPDTLYAKAYKYLEEVT FYRYVRQDFWWKFQRWRST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39480		CYP96A9	"cytochrome P450, family 96, s...		Lus10018157 [exp]	0	1
AT3G05210		UVR7, ERCC1	UV REPAIR DEFICIENT 7, nucleot...		Lus10029947 [exp]	11.2	0.8012
					Lus10008289 [exp]	12.1	0.8096
					Lus10034871 [exp]	17.6	0.7971
AT5G67470		ATFH6	ARABIDOPSIS FORMIN HOMOLOG 6, ...		Lus10002464 [exp]	19.7	0.7732
AT3G14570		ATGSL4, ATGSL04	glucan synthase-like 4 (.1.2)		Lus10026188 [exp]	19.9	0.8006
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10028306 [exp]	25.8	0.7991
AT5G45275			Major facilitator superfamily ...		Lus10033280 [exp]	27.4	0.7960
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10004652 [exp]	32.5	0.7933
					Lus10000650 [exp]	37.5	0.7855
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006303 [exp]	38.5	0.7813

Compare expression of checked genes

Lus10018157 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.