Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23180 91 / 1e-22 CYP96A1 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) AT4G39480 91 / 1e-22 CYP96A9 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) AT2G21910 90 / 3e-22 CYP96A5 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) AT4G39490 88 / 2e-21 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT4G00360 86 / 7e-21 ATT1, CYP86A2 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) AT5G23190 86 / 1e-20 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) AT1G65340 84 / 3e-20 CYP96A3 "cytochrome P450, family 96, subfamily A, polypeptide 3", cytochrome P450, family 96, subfamily A, polypeptide 3 (.1) AT1G01600 82 / 1e-19 CYP86A4 "cytochrome P450, family 86, subfamily A, polypeptide 4", cytochrome P450, family 86, subfamily A, polypeptide 4 (.1) AT1G57750 81 / 3e-19 MAH1, CYP96A15 MID-CHAIN ALKANE HYDROXYLASE 1, "cytochrome P450, family 96, subfamily A, polypeptide 15", cytochrome P450, family 96, subfamily A, polypeptide 15 (.1.2) AT5G58860 81 / 4e-19 CYP86A1 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015306 [exp] 172 / 4e-51 AT4G39490 342 / 3e-108 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10025678 [exp] 164 / 8e-50 AT4G39490 363 / 9e-121 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10028047 [exp] 144 / 4e-42 AT2G21910 375 / 1e-125 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) Lus10003756 [exp] 137 / 1e-41 AT2G23180 219 / 1e-68 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10018161 [exp] 132 / 1e-40 AT4G39480 204 / 5e-64 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) Lus10025677 [exp] 138 / 7e-40 AT2G23180 361 / 1e-119 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10018160 [exp] 115 / 9e-34 AT2G23180 127 / 4e-45 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10015307 [exp] 110 / 2e-31 AT2G23180 219 / 6e-69 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10022279 [exp] 105 / 7e-28 AT2G23180 449 / 4e-154 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G080300 [exp] 102 / 1e-26 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.001G397900 [exp] 101 / 3e-26 AT4G39490 480 / 6e-166 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.005G064400 [exp] 97 / 8e-25 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.014G085800 [exp] 92 / 5e-23 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.015G132800 [exp] 91 / 2e-22 AT4G39490 589 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G086900 [exp] 89 / 5e-22 AT2G23180 455 / 2e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.009G043700 [exp] 87 / 3e-21 AT5G58860 827 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.001G249700 [exp] 85 / 2e-20 AT5G58860 790 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.005G092200 [exp] 85 / 2e-20 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.007G072100 [exp] 84 / 4e-20 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10018158 pacid=23145242 polypeptide=Lus10018158 locus=Lus10018158.g ID=Lus10018158.BGIv1.0 annot-version=v1.0 ATGCGGCAATTCTGTTTTCGATGTATTCACGACGAGGATGGAAAATGTCTAGGGCAAGATTGCATGGAGTTTAAACCGGAGCAGTGGATTAGCGAAGAAT GCGATAAGATTGTTCACGTCCCGTTGTACAAATTCTCAGCGTTTCTGGTTGGACCTAGGGCTTGTTTGGGGAAGAAGATTGCTTTCTGGCATGCCAAGCA AGTGACAAGTGCTCTGATTTATATCTATAAGGTGGAGTTGGTCAAAGGACATCCTATTGCGCCTGTAGTTTCGATCACGTTGTTCATAAAAGACTGTCTA AAAATTCGAATCTCGAGGAGAAAGTAA
AA sequence Show only first row Show all	>Lus10018158 pacid=23145242 polypeptide=Lus10018158 locus=Lus10018158.g ID=Lus10018158.BGIv1.0 annot-version=v1.0 MRQFCFRCIHDEDGKCLGQDCMEFKPEQWISEECDKIVHVPLYKFSAFLVGPRACLGKKIAFWHAKQVTSALIYIYKVELVKGHPIAPVVSITLFIKDCL KIRISRRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21910		CYP96A5	"cytochrome P450, family 96, s...		Lus10018158 [exp]	0	1
					Lus10027773 [exp]	2.0	0.8831
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10040226 [exp]	3.0	0.9082
AT3G19610			Plant protein of unknown funct...		Lus10012367 [exp]	3.9	0.8161
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10021233 [exp]	6.8	0.8849
AT4G28380			Leucine-rich repeat (LRR) fami...		Lus10017713 [exp]	8.3	0.8833
AT5G65165		SDH2-3	succinate dehydrogenase 2-3 (....		Lus10028289 [exp]	8.9	0.8823
AT5G59340	HD	WOX2	WUSCHEL related homeobox 2 (.1...		Lus10040840 [exp]	11.2	0.8690
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10036963 [exp]	12.5	0.8310
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10023335 [exp]	16.1	0.8724
AT1G56140			Leucine-rich repeat transmembr...		Lus10031777 [exp]	21.5	0.8563

Compare expression of checked genes

Lus10018158 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.