Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13150 48 / 9e-07 CYP86C4 "cytochrome P450, family 86, subfamily C, polypeptide 4", cytochrome P450, family 86, subfamily C, polypeptide 4 (.1) AT4G39510 47 / 3e-06 CYP96A12 "cytochrome P450, family 96, subfamily A, polypeptide 12", cytochrome P450, family 96, subfamily A, polypeptide 12 (.1) AT4G39480 46 / 5e-06 CYP96A9 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) AT4G39490 45 / 1e-05 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT5G08250 45 / 1e-05 Cytochrome P450 superfamily protein (.1) AT5G02900 44 / 2e-05 CYP96A13 "cytochrome P450, family 96, subfamily A, polypeptide 13", cytochrome P450, family 96, subfamily A, polypeptide 13 (.1) AT1G13140 44 / 2e-05 CYP86C3 "cytochrome P450, family 86, subfamily C, polypeptide 3", cytochrome P450, family 86, subfamily C, polypeptide 3 (.1.2) AT4G32170 44 / 2e-05 CYP96A2 "cytochrome P450, family 96, subfamily A, polypeptide 2", cytochrome P450, family 96, subfamily A, polypeptide 2 (.1) AT1G24540 42 / 0.0001 CYP86C1 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) AT3G26125 41 / 0.0002 CYP86C2 "cytochrome P450, family 86, subfamily C, polypeptide 2", cytochrome P450, family 86, subfamily C, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015306 [exp] 117 / 9e-31 AT4G39490 342 / 3e-108 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10028047 [exp] 97 / 1e-23 AT2G21910 375 / 1e-125 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) Lus10025678 [exp] 96 / 4e-23 AT4G39490 363 / 9e-121 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10018157 [exp] 83 / 7e-20 AT4G39480 115 / 1e-29 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) Lus10018162 [exp] 68 / 5e-14 AT4G39490 113 / 7e-29 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10002525 [exp] 57 / 1e-09 AT4G39490 410 / 2e-138 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10022279 [exp] 56 / 2e-09 AT2G23180 449 / 4e-154 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10003669 [exp] 56 / 3e-09 AT2G23180 440 / 4e-150 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10002527 [exp] 55 / 4e-09 AT2G23180 454 / 7e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G064400 [exp] 56 / 2e-09 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G086900 [exp] 54 / 1e-08 AT2G23180 455 / 2e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.008G183300 [exp] 54 / 1e-08 AT1G24540 682 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.010G050100 [exp] 53 / 2e-08 AT1G24540 684 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.002G042100 [exp] 50 / 2e-07 AT3G48520 451 / 1e-154 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) Potri.002G042200 [exp] 50 / 2e-07 AT5G63450 442 / 3e-151 "cytochrome P450, family 94, subfamily B, polypeptide 1", cytochrome P450, family 94, subfamily B, polypeptide 1 (.1) Potri.005G220900 [exp] 50 / 2e-07 AT3G48520 414 / 2e-140 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) Potri.007G080300 [exp] 49 / 4e-07 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G132800 [exp] 46 / 5e-06 AT4G39490 589 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.005G220700 [exp] 46 / 6e-06 AT3G48520 436 / 4e-149 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018159 pacid=23145186 polypeptide=Lus10018159 locus=Lus10018159.g ID=Lus10018159.BGIv1.0 annot-version=v1.0 ATGGCCCCGAGTTCAAAGACAAGCTCAACGCCTTGGGGGAAGGCATCTTCGCTATGGATGGAGAATCCGGCCTCTCCCAGCGCCGGATCCTCCGCTCAGT CTTCAAGTCTCCACCATTTGAACAGCTTCTCAACACTTCCCTCCTCGAAAAGCTCGGCATGTTCCCCGTCCTGGACCGTGCGGTTGGCGCGGTCAGGAGA AGAGCTAGACATGCAGAACGTGCACAAGAGGTTCATGTTCGACAGCATTTGCACGACGGTGCACGGATATGATCCGAATTATCTCACCGTCGAATTACTC CCCGACGTCCTGTACGCCAAGGCGTATGAGGACCTCGAGGAGGAAACCGGTACCTCATGCTGGATTTCTGGTGGAAATTTCAGAGATGGGCCGGAATCGG AGAAGAGAGGAAGTACAAAAAAGCGCTGTAGAAATTCAACAAATTCCTCTACGAGAGGATCAATGTCAAGAGAGGGAGCCTTTACGAAACAGATGAGGGG GGAAATGATCAGTTCGACTTTCTGA
AA sequence Show only first row Show all	>Lus10018159 pacid=23145186 polypeptide=Lus10018159 locus=Lus10018159.g ID=Lus10018159.BGIv1.0 annot-version=v1.0 MAPSSKTSSTPWGKASSLWMENPASPSAGSSAQSSSLHHLNSFSTLPSSKSSACSPSWTVRLARSGEELDMQNVHKRFMFDSICTTVHGYDPNYLTVELL PDVLYAKAYEDLEEETGTSCWISGGNFRDGPESEKRGSTKKRCRNSTNSSTRGSMSREGAFTKQMRGEMISSTF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39510		CYP96A12	"cytochrome P450, family 96, s...		Lus10018159 [exp]	0	1
AT3G17130			Plant invertase/pectin methyle...		Lus10017074 [exp]	2.8	0.8213
AT2G15220			Plant basic secretory protein ...		Lus10013863 [exp]	4.5	0.6964
					Lus10041371 [exp]	11.0	0.8018
AT3G25280			Major facilitator superfamily ...		Lus10025881 [exp]	13.9	0.6994
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Lus10029634 [exp]	16.6	0.7555
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10041372 [exp]	21.0	0.7776
AT3G20750	GATA	GATA29	GATA transcription factor 29 (...		Lus10042504 [exp]	28.2	0.6844
AT2G37730			Protein of unknown function (D...		Lus10024364 [exp]	45.7	0.6728
AT1G64090		RTNLB3	Reticulan like protein B3 (.1....		Lus10027548 [exp]	67.0	0.6590
AT3G19940			Major facilitator superfamily ...		Lus10028729 [exp]	73.1	0.6527

Compare expression of checked genes

Lus10018159 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.