Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39480 206 / 2e-64 CYP96A9 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) AT2G23180 202 / 5e-63 CYP96A1 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) AT4G39490 201 / 1e-62 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT2G21910 190 / 2e-58 CYP96A5 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) AT1G65340 176 / 4e-53 CYP96A3 "cytochrome P450, family 96, subfamily A, polypeptide 3", cytochrome P450, family 96, subfamily A, polypeptide 3 (.1) AT1G57750 175 / 5e-53 MAH1, CYP96A15 MID-CHAIN ALKANE HYDROXYLASE 1, "cytochrome P450, family 96, subfamily A, polypeptide 15", cytochrome P450, family 96, subfamily A, polypeptide 15 (.1.2) AT1G47620 171 / 4e-51 CYP96A8 "cytochrome P450, family 96, subfamily A, polypeptide 8", cytochrome P450, family 96, subfamily A, polypeptide 8 (.1) AT4G32170 171 / 4e-51 CYP96A2 "cytochrome P450, family 96, subfamily A, polypeptide 2", cytochrome P450, family 96, subfamily A, polypeptide 2 (.1) AT4G39500 169 / 6e-51 CYP96A11 "cytochrome P450, family 96, subfamily A, polypeptide 11", cytochrome P450, family 96, subfamily A, polypeptide 11 (.1) AT5G52320 169 / 1e-50 CYP96A4 "cytochrome P450, family 96, subfamily A, polypeptide 4", cytochrome P450, family 96, subfamily A, polypeptide 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015307 [exp] 305 / 5e-107 AT2G23180 219 / 6e-69 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10025677 [exp] 308 / 2e-104 AT2G23180 361 / 1e-119 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10025678 [exp] 260 / 1e-85 AT4G39490 363 / 9e-121 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10028047 [exp] 259 / 3e-85 AT2G21910 375 / 1e-125 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) Lus10003756 [exp] 246 / 1e-83 AT2G23180 219 / 1e-68 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10015306 [exp] 250 / 7e-79 AT4G39490 342 / 3e-108 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10022277 [exp] 217 / 7e-69 AT4G39490 395 / 1e-132 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10002525 [exp] 215 / 5e-68 AT4G39490 410 / 2e-138 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10002527 [exp] 213 / 2e-67 AT2G23180 454 / 7e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G064400 [exp] 213 / 4e-67 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.007G080300 [exp] 206 / 2e-64 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.001G397900 [exp] 205 / 4e-64 AT4G39490 480 / 6e-166 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G086900 [exp] 188 / 1e-57 AT2G23180 455 / 2e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.015G132800 [exp] 180 / 8e-55 AT4G39490 589 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.008G125300 [exp] 174 / 1e-52 AT4G39490 410 / 4e-139 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.014G085800 [exp] 162 / 2e-47 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.003G129100 [exp] 159 / 3e-46 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Potri.009G043700 [exp] 157 / 5e-46 AT5G58860 827 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.010G050100 [exp] 157 / 5e-46 AT1G24540 684 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10018161 pacid=23145228 polypeptide=Lus10018161 locus=Lus10018161.g ID=Lus10018161.BGIv1.0 annot-version=v1.0 ATGAAAACGAATCTCGGAGAAACTTCCGGTAATTGGAAGTTTTTCAGCGAGGAGGAGTTGAACAAGCTAGTGTACCTACACGGTGCGGTTTGCGAGGCGC TCCGGCTGTACCCGCCTGTGCCGTTTGATCACAGGACGGCGACAGAGGAGGATACGTTACCTACCGGGCATGTCGTTAGGAAGAACAGGATGGTTCTCTT TTCGATATATTCGATAGGGAGGATGGAGGAGATTTGGGGGGAGGATTGGATGGAGTTCAAGCCGGAGCGATGGATCAACTCCGAAGGGAACAAGATTGTT TACGTCCCGTCGTACAAGTTCATGACGTTTGCTGCCGGGCCGAGATCTTGCTTGGGGAAGAAGATTGCTTTCTTGTATGCCAAGCAAGCGGCGAGTGCTT TGCTTTATAACTATAAGGTGGAGTTGGTTGAAGGGCATCATGTCGCGCCTGCGGTTTCCATTGTGATGTTTATGAAAGATAGTTTGAAAGTTAGAGTGTC GAAAAGAGAGGTGATTTAA
AA sequence Show only first row Show all	>Lus10018161 pacid=23145228 polypeptide=Lus10018161 locus=Lus10018161.g ID=Lus10018161.BGIv1.0 annot-version=v1.0 MKTNLGETSGNWKFFSEEELNKLVYLHGAVCEALRLYPPVPFDHRTATEEDTLPTGHVVRKNRMVLFSIYSIGRMEEIWGEDWMEFKPERWINSEGNKIV YVPSYKFMTFAAGPRSCLGKKIAFLYAKQAASALLYNYKVELVEGHHVAPAVSIVMFMKDSLKVRVSKREVI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39480		CYP96A9	"cytochrome P450, family 96, s...		Lus10018161 [exp]	0	1
AT4G33860			Glycosyl hydrolase family 10 p...		Lus10033786 [exp]	1.0	0.9561
AT2G40100		LHCB4.3	light harvesting complex photo...		Lus10040191 [exp]	1.4	0.9467
AT1G47480			alpha/beta-Hydrolases superfam...		Lus10019884 [exp]	1.7	0.9456
AT4G21960		PRXR1	Peroxidase superfamily protein...		Lus10006778 [exp]	2.6	0.9217
AT5G42760			Leucine carboxyl methyltransfe...		Lus10000713 [exp]	2.8	0.9382
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Lus10003143 [exp]	3.2	0.9295
AT2G36270	bZIP	EEL, GIA1, ABI5	GROWTH-INSENSITIVITY TO ABA 1,...		Lus10022720 [exp]	4.2	0.9180
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Lus10018162 [exp]	4.9	0.9192
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10015307 [exp]	5.3	0.9076
AT1G18265			Protein of unknown function, D...		Lus10035638 [exp]	7.4	0.9136

Compare expression of checked genes

Lus10018161 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.