Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02340 76 / 9e-18 ATPP2-B8 phloem protein 2-B8 (.1) AT2G02360 68 / 5e-15 ATPP2-B10 phloem protein 2-B10 (.1) AT2G02240 67 / 2e-14 MEE66 maternal effect embryo arrest 66, F-box family protein (.1) AT2G02310 66 / 4e-14 ATPP2-B6 phloem protein 2-B6 (.1) AT2G02250 65 / 6e-14 ATPP2-B2 phloem protein 2-B2 (.1) AT5G24560 64 / 9e-14 ATPP2-B12 phloem protein 2-B12 (.1) AT2G02230 64 / 3e-13 ATPP2-B1 phloem protein 2-B1 (.1) AT2G02320 63 / 4e-13 ATPP2-B7 phloem protein 2-B7 (.1) AT1G80110 59 / 7e-12 ATPP2-B11 phloem protein 2-B11 (.1) AT1G09155 58 / 3e-11 ATPP2-B15 phloem protein 2-B15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025661 [exp] 155 / 2e-48 AT2G02340 109 / 7e-28 phloem protein 2-B8 (.1) Lus10025662 [exp] 98 / 3e-28 AT2G02340 58 / 2e-11 phloem protein 2-B8 (.1) Lus10025660 [exp] 99 / 6e-27 AT2G02360 183 / 9e-57 phloem protein 2-B10 (.1) Lus10042712 [exp] 83 / 1e-20 AT2G02230 179 / 6e-55 phloem protein 2-B1 (.1) Lus10029673 [exp] 79 / 5e-19 AT2G02230 180 / 4e-55 phloem protein 2-B1 (.1) Lus10018171 [exp] 79 / 1e-18 AT2G02240 219 / 2e-69 maternal effect embryo arrest 66, F-box family protein (.1) Lus10025666 [exp] 78 / 2e-18 AT5G24560 219 / 5e-69 phloem protein 2-B12 (.1) Lus10020674 [exp] 69 / 3e-15 AT1G09155 266 / 7e-89 phloem protein 2-B15 (.1) Lus10029872 [exp] 67 / 9e-15 AT1G09155 272 / 3e-91 phloem protein 2-B15 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G267000 [exp] 72 / 2e-16 AT2G02240 239 / 1e-77 maternal effect embryo arrest 66, F-box family protein (.1) Potri.018G016000 [exp] 66 / 3e-14 AT2G02250 220 / 2e-70 phloem protein 2-B2 (.1) Potri.018G015800 [exp] 64 / 1e-13 AT2G02240 242 / 1e-78 maternal effect embryo arrest 66, F-box family protein (.1) Potri.001G050100 [exp] 63 / 3e-13 AT2G02360 219 / 5e-71 phloem protein 2-B10 (.1) Potri.005G022000 [exp] 63 / 3e-13 AT1G09155 290 / 4e-98 phloem protein 2-B15 (.1) Potri.018G016100 [exp] 59 / 8e-12 AT2G02250 217 / 2e-69 phloem protein 2-B2 (.1) Potri.006G266900 [exp] 58 / 2e-11 AT2G02240 215 / 2e-68 maternal effect embryo arrest 66, F-box family protein (.1) Potri.003G121900 [exp] 56 / 1e-10 AT1G12710 401 / 9e-142 phloem protein 2-A12 (.1) Potri.001G109800 [exp] 55 / 3e-10 AT1G12710 408 / 1e-144 phloem protein 2-A12 (.1) Potri.015G138600 [exp] 52 / 3e-09 AT5G52120 356 / 3e-124 phloem protein 2-A14 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018175 pacid=23145191 polypeptide=Lus10018175 locus=Lus10018175.g ID=Lus10018175.BGIv1.0 annot-version=v1.0 ATGGACAAATTGCCAGAGGAATGCATGGAAAAGCTGATGTCGTACGTCGGACCTCAGCAGACTTGCAGGCGGGCTGTCCTCTGGAAATCGCTATGGTCAG CTTCGCAATCGGAGCAACTCTGGGAAAGCTTCCTTCCGGCGGACTACGAATCGGTGATCTCCCAGACGGCATCTCTCAATCTTCTTCAGATATCCGACCG TCGACAGCTCGTCCGCCGGCTCTGCAAACGCCCACTCCTAATCGACGAGGGCAAAAAGGTCAGACTTCGATGA
AA sequence Show only first row Show all	>Lus10018175 pacid=23145191 polypeptide=Lus10018175 locus=Lus10018175.g ID=Lus10018175.BGIv1.0 annot-version=v1.0 MDKLPEECMEKLMSYVGPQQTCRRAVLWKSLWSASQSEQLWESFLPADYESVISQTASLNLLQISDRRQLVRRLCKRPLLIDEGKKVRLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02340		ATPP2-B8	phloem protein 2-B8 (.1)		Lus10018175 [exp]	0	1
					Lus10026090 [exp]	3.5	0.7700
AT5G22260		MS1	male sterility 1, RING/FYVE/PH...		Lus10030773 [exp]	4.1	0.7997
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10007891 [exp]	4.9	0.7946
					Lus10043115 [exp]	7.2	0.7079
AT1G07380			Neutral/alkaline non-lysosomal...		Lus10034565 [exp]	13.3	0.7733
AT2G26250		KCS10, FDH	FIDDLEHEAD, 3-ketoacyl-CoA syn...		Lus10028105 [exp]	14.0	0.7697
AT1G08230		ATGAT1	L-GAMMA-AMINOBUTYRIC ACID TRAN...		Lus10037913 [exp]	16.8	0.6832
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10022312 [exp]	17.4	0.7589
AT4G34750			SAUR-like auxin-responsive pro...		Lus10021130 [exp]	18.0	0.7226
					Lus10022880 [exp]	18.1	0.7679

Compare expression of checked genes

Lus10018175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.