Lus10018190 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G44760 165 / 3e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G69080 67 / 5e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT2G03720 66 / 6e-14 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT5G17390 61 / 2e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03290 54 / 4e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT4G13450 47 / 8e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025644 214 / 5e-72 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10029664 169 / 1e-53 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10042701 165 / 2e-52 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10019173 79 / 2e-18 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10036814 57 / 5e-11 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10034661 57 / 2e-10 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10007982 50 / 7e-08 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10023716 40 / 0.0001 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10014459 40 / 0.0002 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G177100 152 / 4e-47 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G084600 147 / 6e-45 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G140200 73 / 5e-16 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.008G109000 72 / 7e-16 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.T170801 71 / 2e-15 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G060700 62 / 3e-12 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10018190 pacid=23145172 polypeptide=Lus10018190 locus=Lus10018190.g ID=Lus10018190.BGIv1.0 annot-version=v1.0
ATGGAAGGAATGAGGAGGAAGAGGGTTATGGTGGTGGTGGATGAGAGTTCACATTCGAAGCATGCTTTGATTTGGGCACTTACTCATATGGTTAATCACT
CTGATTTGCTCACTCTGCTTCATATAACCACTTCTTCTTCTTATTCTTCCTCTTTGATTGTTGATTCCCTTGCTTCCCTCTGCAAAGCCTGCAACCCTGA
GGTGGACGTTGAGGCATTGGTGGTGCAAGGGCCAAAGTTGGGGACAGTAATTAGACAAGTGAAGAAGCTTGATGTTTCTGTTCTTGTTCTTGGTCACAAG
AAGCCCTCTTCCTTTACCAGTTGCCTAAGTGGAAGAAGAAGCAGCAGTGAAGAGCTAGTGGAAGAGTGCATAAAGAGTGTGGAGAGGTGCATGATAGTTG
GGTTGAGGAAGCAGAGCAATGGCAAGAGTGGCTATCTCATCACTACCAAATGGCAGACGAACTTCTGGCTCTTGGCTTAA
AA sequence
>Lus10018190 pacid=23145172 polypeptide=Lus10018190 locus=Lus10018190.g ID=Lus10018190.BGIv1.0 annot-version=v1.0
MEGMRRKRVMVVVDESSHSKHALIWALTHMVNHSDLLTLLHITTSSSYSSSLIVDSLASLCKACNPEVDVEALVVQGPKLGTVIRQVKKLDVSVLVLGHK
KPSSFTSCLSGRRSSSEELVEECIKSVERCMIVGLRKQSNGKSGYLITTKWQTNFWLLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G44760 Adenine nucleotide alpha hydro... Lus10018190 0 1
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10041538 2.6 0.9603
AT1G27950 LTPG1 glycosylphosphatidylinositol-a... Lus10015779 3.2 0.9598
AT1G14600 GARP Homeodomain-like superfamily p... Lus10035093 6.7 0.9519
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10026076 6.7 0.9593
AT1G63640 P-loop nucleoside triphosphate... Lus10024628 7.3 0.9272
AT4G03270 CYCD6;1 Cyclin D6;1 (.1) Lus10039738 8.5 0.9534
AT3G63300 FKD1 FORKED 1 (.1.2) Lus10004079 10.5 0.9462
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10000473 12.0 0.9493
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10021408 13.3 0.9416
AT4G03270 CYCD6;1 Cyclin D6;1 (.1) Lus10018520 14.0 0.9439

Lus10018190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.