Lus10018204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52390 69 / 4e-15 PAR1 protein (.1)
AT3G54040 63 / 4e-13 PAR1 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040714 177 / 1e-57 AT5G52390 136 / 2e-40 PAR1 protein (.1)
Lus10040702 167 / 7e-54 AT5G52390 138 / 2e-41 PAR1 protein (.1)
Lus10040715 148 / 6e-46 AT5G52390 138 / 4e-41 PAR1 protein (.1)
Lus10016450 147 / 5e-44 AT5G52390 137 / 6e-39 PAR1 protein (.1)
Lus10012788 67 / 5e-14 AT5G52390 198 / 7e-64 PAR1 protein (.1)
Lus10017196 65 / 1e-13 AT3G54040 191 / 1e-62 PAR1 protein (.1)
Lus10021114 64 / 3e-13 AT3G54040 192 / 6e-63 PAR1 protein (.1)
Lus10033988 64 / 8e-13 AT5G52390 194 / 3e-62 PAR1 protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G039950 78 / 7e-19 AT3G54040 140 / 1e-42 PAR1 protein (.1)
Potri.009G040000 78 / 2e-18 AT5G52390 141 / 3e-42 PAR1 protein (.1)
Potri.006G094300 73 / 4e-17 AT3G54040 198 / 2e-65 PAR1 protein (.1)
Potri.016G106800 73 / 5e-17 AT3G54040 191 / 1e-62 PAR1 protein (.1)
Potri.015G144800 70 / 1e-15 AT5G52390 208 / 5e-69 PAR1 protein (.1)
Potri.012G141800 67 / 1e-14 AT5G52390 213 / 6e-71 PAR1 protein (.1)
Potri.009G039900 57 / 4e-11 AT3G54040 118 / 4e-34 PAR1 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06521 PAR1 PAR1 protein
Representative CDS sequence
>Lus10018204 pacid=23179353 polypeptide=Lus10018204 locus=Lus10018204.g ID=Lus10018204.BGIv1.0 annot-version=v1.0
ATGAAGGACATGATCCAGTCGGATGAATGCATCAAGGCATGCGGCGTCGTCAGAAACACCGTAGGGATCTCTTCAGATTACCTCCTCAATCATAAGTTCG
TGTCCCGGCTCTGCTCCAGATCCTGCTCCCAATCCTGCCCCAACATCGTCGACCTCTACTCCAACTTGGCTCTAGCTGAAGGGATGGATTTGTACGGTAT
GTGCAGCTTGGGTGGTCGTCTTAGGTCGTTGTTGCAGCCTAAGAGTTCGAGTGATGCTCTGGCTAAGGGTGCAATTGGAGGGCCGATTAGTTCACCAATG
TCTTCTGCAGTTGGTCTTGATGATGCTGATGCCACTGCTTTTTGTCCCTCTTCTGATGCCAGTACTGCTTTTTGTCCCTCTTCTGATGCATACTGA
AA sequence
>Lus10018204 pacid=23179353 polypeptide=Lus10018204 locus=Lus10018204.g ID=Lus10018204.BGIv1.0 annot-version=v1.0
MKDMIQSDECIKACGVVRNTVGISSDYLLNHKFVSRLCSRSCSQSCPNIVDLYSNLALAEGMDLYGMCSLGGRLRSLLQPKSSSDALAKGAIGGPISSPM
SSAVGLDDADATAFCPSSDASTAFCPSSDAY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52390 PAR1 protein (.1) Lus10018204 0 1
AT1G29970 RPL18AA 60S ribosomal protein L18A-1 (... Lus10026180 1.0 0.9869
AT2G02850 ARPN plantacyanin (.1) Lus10041848 7.5 0.9009
Lus10017959 8.8 0.9526
Lus10009411 9.6 0.9398
AT4G35220 Cyclase family protein (.1) Lus10027872 9.7 0.9633
Lus10001476 10.3 0.9238
AT5G25180 CYP71B14 "cytochrome P450, family 71, s... Lus10033634 11.0 0.8881
Lus10025268 12.1 0.9618
AT4G39670 Glycolipid transfer protein (G... Lus10035024 14.0 0.8691
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026232 14.0 0.9618

Lus10018204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.