Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040690 [exp] 159 / 1e-51 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G249500 [exp] 64 / 6e-14 AT1G07300 49 / 2e-08 josephin protein-related (.1) Potri.009G043501 [exp] 63 / 7e-14 AT1G07300 / josephin protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018215 pacid=23179330 polypeptide=Lus10018215 locus=Lus10018215.g ID=Lus10018215.BGIv1.0 annot-version=v1.0 ATGATTACGAGGAGCAAAAGCCAAGGAAGTCATCACAATATGCCAACATCATCCATCAGTGGAGGAGGCAGAGGAGGATCCGGGTTGCTTCGATGTTTGA GGTTCTGCAGGCTGGGAAAGAGGTCGTCGTTAATGGAGATTCAGCAGCCTGTTGGAAATAATGGGTTGAAGGATCTGAGTGATAAGGTGGCTAAAGCATT GTGCTTCAAGTGTAGGAGTACATGCCGGGTTTCTTCATCCTCTGCGGGCGGATACAGGTCTCCGTATGGTGTTTCTCCGCTTGATGTTCATAGGAAAGAG GCCATAAAGGACTGTATTGAGTTCATCAACCACTCCTCTTCTCTACCTCGATCCAACTCTGTCTCTGCTGCTTAG
AA sequence Show only first row Show all	>Lus10018215 pacid=23179330 polypeptide=Lus10018215 locus=Lus10018215.g ID=Lus10018215.BGIv1.0 annot-version=v1.0 MITRSKSQGSHHNMPTSSISGGGRGGSGLLRCLRFCRLGKRSSLMEIQQPVGNNGLKDLSDKVAKALCFKCRSTCRVSSSSAGGYRSPYGVSPLDVHRKE AIKDCIEFINHSSSLPRSNSVSAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018215 [exp]	0	1
AT5G58960		GIL1	GRAVITROPIC IN THE LIGHT, Plan...		Lus10016444 [exp]	1.4	0.9236
					Lus10040690 [exp]	1.4	0.9184
AT4G37650	GRAS	SGR7, SHR	SHORT ROOT, SHOOT GRAVITROPISM...		Lus10025200 [exp]	1.7	0.9130
AT4G33840			Glycosyl hydrolase family 10 p...		Lus10014642 [exp]	5.5	0.9016
AT1G22710		SUT1, ATSUC2, S...	SUCROSE TRANSPORTER 1, ARABIDO...		Lus10007702 [exp]	5.7	0.9058
AT2G32210			unknown protein		Lus10031204 [exp]	5.9	0.8765
AT4G21500			unknown protein		Lus10011256 [exp]	7.1	0.8725
AT3G60160		ATMRP9, ABCC9	ATP-binding cassette C9, multi...		Lus10042023 [exp]	7.2	0.8475
AT4G35150			O-methyltransferase family pro...		Lus10006691 [exp]	8.0	0.8759
					Lus10014941 [exp]	8.2	0.8109

Compare expression of checked genes

Lus10018215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.