Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07230 87 / 1e-21 NPC1 non-specific phospholipase C1 (.1) AT3G48610 66 / 4e-14 NPC6 non-specific phospholipase C6 (.1) AT2G26870 61 / 2e-12 NPC2 non-specific phospholipase C2 (.1) AT3G03520 39 / 0.0001 NPC3 non-specific phospholipase C3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040678 [exp] 130 / 3e-37 AT1G07230 809 / 0.0 non-specific phospholipase C1 (.1) Lus10005860 [exp] 116 / 6e-32 AT1G07230 810 / 0.0 non-specific phospholipase C1 (.1) Lus10001208 [exp] 78 / 1e-19 AT1G07230 213 / 1e-67 non-specific phospholipase C1 (.1) Lus10036038 [exp] 65 / 9e-14 AT2G26870 423 / 1e-147 non-specific phospholipase C2 (.1) Lus10035935 [exp] 65 / 1e-13 AT3G48610 773 / 0.0 non-specific phospholipase C6 (.1) Lus10025726 [exp] 65 / 2e-13 AT3G48610 774 / 0.0 non-specific phospholipase C6 (.1) Lus10009690 [exp] 61 / 4e-12 AT2G26870 258 / 9e-82 non-specific phospholipase C2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G045100 [exp] 111 / 3e-30 AT1G07230 815 / 0.0 non-specific phospholipase C1 (.1) Potri.001G250500 [exp] 104 / 8e-28 AT1G07230 820 / 0.0 non-specific phospholipase C1 (.1) Potri.012G099300 [exp] 69 / 2e-15 AT3G48610 834 / 0.0 non-specific phospholipase C6 (.1) Potri.015G097900 [exp] 69 / 4e-15 AT3G48610 813 / 0.0 non-specific phospholipase C6 (.1) Potri.009G069900 [exp] 68 / 1e-14 AT2G26870 786 / 0.0 non-specific phospholipase C2 (.1) Potri.001G275500 [exp] 58 / 3e-11 AT2G26870 769 / 0.0 non-specific phospholipase C2 (.1) Potri.013G073600 [exp] 44 / 3e-06 AT3G03530 709 / 0.0 non-specific phospholipase C4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018228 pacid=23179289 polypeptide=Lus10018228 locus=Lus10018228.g ID=Lus10018228.BGIv1.0 annot-version=v1.0 ATGCAAAACTCTCAAGAGTTCCAAATGGAACTAGTCCAGCTCGCCTCCCAGCTGAATGGTGACTATGTGTTGAACACTTACCCCGATATTGGCAAGAGCA TGACTGTACCTGAAGCAAAAAAGTACACTGAAGGTACAGTCCAGAGATTCCTGGAAGCTGGGAAAGCTGCACTAAAAGCCGGAGCTAACGATTCTGCCAT TGTCATGATGAGACCTTCCCTCACTAGCCGGATTCCGGTAGGGAACTCTCGTAACTATGTAGAAGCCTATTAG
AA sequence Show only first row Show all	>Lus10018228 pacid=23179289 polypeptide=Lus10018228 locus=Lus10018228.g ID=Lus10018228.BGIv1.0 annot-version=v1.0 MQNSQEFQMELVQLASQLNGDYVLNTYPDIGKSMTVPEAKKYTEGTVQRFLEAGKAALKAGANDSAIVMMRPSLTSRIPVGNSRNYVEAY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07230		NPC1	non-specific phospholipase C1 ...		Lus10018228 [exp]	0	1
AT1G07360	C3HZnF	MAC5A	MOS4-associated complex subuni...		Lus10012448 [exp]	1.7	0.8158
AT5G20990		B73, CNX1, SIR4...	SIRTINOL 4, CO-FACTOR FOR NITR...		Lus10000717 [exp]	3.7	0.7902
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10004309 [exp]	9.6	0.7447
AT1G53330			Pentatricopeptide repeat (PPR)...		Lus10026218 [exp]	12.0	0.6920
AT1G71460			Pentatricopeptide repeat (PPR-...		Lus10006174 [exp]	23.0	0.6744
AT4G19770			Glycosyl hydrolase family prot...		Lus10003408 [exp]	25.7	0.6904
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Lus10035109 [exp]	28.0	0.7238
AT4G39050			Kinesin motor family protein (...		Lus10017906 [exp]	29.8	0.6548
AT5G40410			Tetratricopeptide repeat (TPR)...		Lus10005638 [exp]	37.5	0.6277
					Lus10008005 [exp]	37.7	0.6708

Compare expression of checked genes

Lus10018228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.