Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30000 223 / 2e-77 PHF5-like protein (.1) AT1G07170 223 / 2e-77 PHF5-like protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040654 [exp] 223 / 2e-77 AT1G07170 223 / 3e-77 PHF5-like protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G277700 [exp] 223 / 2e-77 AT2G30000 223 / 3e-77 PHF5-like protein (.1) Potri.009G072300 [exp] 223 / 2e-77 AT2G30000 223 / 3e-77 PHF5-like protein (.1) Potri.001G277800 [exp] 218 / 7e-75 AT2G30000 217 / 2e-74 PHF5-like protein (.1) Potri.009G072400 [exp] 213 / 1e-73 AT2G30000 214 / 1e-73 PHF5-like protein (.1) Potri.008G028300 [exp] 116 / 1e-35 AT2G30000 115 / 1e-35 PHF5-like protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03660 [flax] [poplar] PHF5 PHF5-like protein
Representative CDS sequence Show only first row Show all	>Lus10018253 pacid=23179265 polypeptide=Lus10018253 locus=Lus10018253.g ID=Lus10018253.BGIv1.0 annot-version=v1.0 ATGGCAAAGCATCATCCTGATTTAATCATGTGTAGAAAGCAACCAGGGATAGCCATTGGAAGACTCTGCGAGAAGTGTGACGGTAAATGCGTAATCTGTG ACTCCTATGTCCGGCCTTGCACGCTGGTGCGAGTCTGCGACGAATGCAACTACGGTTCCTTCCAGGGTCGCTGTGTTATATGCGGAGGAGTCGGTATATC TGATGCATACTACTGCAAGGAGTGCACTCAGCAGGAGAAAGATCGGGATGGCTGTCCGAAGATTGTGAATTTAGGCAGTGCAAAGACTGACTTGTTCTAC GAACGAAAGAAATACGGTTTTAAGAAACGATGA
AA sequence Show only first row Show all	>Lus10018253 pacid=23179265 polypeptide=Lus10018253 locus=Lus10018253.g ID=Lus10018253.BGIv1.0 annot-version=v1.0 MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFY ERKKYGFKKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07170			PHF5-like protein (.1.2.3)		Lus10018253 [exp]	0	1
AT5G58110			chaperone binding;ATPase activ...		Lus10040580 [exp]	1.4	0.8845
AT2G34520		RPS14	mitochondrial ribosomal protei...		Lus10017877 [exp]	1.4	0.8693
AT3G21640		FKBP42, UCU2, T...	ULTRACURVATA 2, TWISTED DWARF ...		Lus10029505 [exp]	7.2	0.8073
AT3G04780			Protein of unknown function (D...		Lus10001780 [exp]	7.3	0.8373
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Lus10031323 [exp]	7.7	0.7761
AT3G21640		FKBP42, UCU2, T...	ULTRACURVATA 2, TWISTED DWARF ...		Lus10039604 [exp]	8.4	0.8048
AT2G37120			S1FA-like DNA-binding protein ...		Lus10023177 [exp]	10.7	0.8006
AT1G77350			unknown protein		Lus10018864 [exp]	12.0	0.7833
AT1G66510			AAR2 protein family (.1.2.3)		Lus10009118 [exp]	12.1	0.7930
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Lus10009495 [exp]	15.6	0.7867

Compare expression of checked genes

Lus10018253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.