Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26170 52 / 3e-08 CYP71B19 "cytochrome P450, family 71, subfamily B, polypeptide 19", cytochrome P450, family 71, subfamily B, polypeptide 19 (.1) AT3G26180 49 / 4e-07 CYP71B20 "cytochrome P450, family 71, subfamily B, polypeptide 20", cytochrome P450, family 71, subfamily B, polypeptide 20 (.1.2) AT4G20240 49 / 5e-07 CYP71A28, CYP71A27 "cytochrome P450, family 71, subfamily A, polypeptide 27", cytochrome P450, family 71, subfamily A, polypeptide 27 (.1) AT5G24950 48 / 9e-07 CYP71A15 "cytochrome P450, family 71, subfamily A, polypeptide 15", cytochrome P450, family 71, subfamily A, polypeptide 15 (.1) AT4G13770 48 / 1e-06 REF2, CYP83A1 REDUCED EPIDERMAL FLUORESCENCE 2, "cytochrome P450, family 83, subfamily A, polypeptide 1", cytochrome P450, family 83, subfamily A, polypeptide 1 (.1) AT5G42590 48 / 1e-06 MRO, CYP71A16 marneral oxidase, cytochrome P450, family 71, subfamily A, polypeptide 16 (.1) AT5G25120 47 / 2e-06 CYP71B11 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) AT5G24960 46 / 4e-06 CYP71A14 "cytochrome P450, family 71, subfamily A, polypeptide 14", cytochrome P450, family 71, subfamily A, polypeptide 14 (.1) AT3G26830 45 / 6e-06 CYP71B15, PAD3 PHYTOALEXIN DEFICIENT 3, Cytochrome P450 superfamily protein (.1) AT2G30770 45 / 7e-06 CYP71A13 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018263 [exp] 117 / 7e-31 AT5G25140 393 / 5e-132 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) Lus10042419 [exp] 89 / 6e-21 AT3G48280 343 / 3e-114 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10002885 [exp] 81 / 3e-18 AT3G48280 396 / 2e-133 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10026252 [exp] 80 / 1e-17 AT5G25120 383 / 2e-123 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10027427 [exp] 73 / 2e-15 AT3G26270 266 / 4e-85 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1) Lus10030708 [exp] 73 / 3e-15 AT3G26210 390 / 6e-131 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10013194 [exp] 71 / 9e-15 AT5G25120 387 / 9e-130 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10030924 [exp] 67 / 4e-13 AT3G26300 391 / 2e-131 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10009903 [exp] 64 / 4e-12 AT5G57260 376 / 1e-125 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G130951 [exp] 64 / 8e-14 AT2G45560 61 / 5e-12 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) Potri.011G131051 [exp] 66 / 5e-13 AT3G48280 218 / 9e-67 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.011G130850 [exp] 66 / 6e-13 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130800 [exp] 65 / 1e-12 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.015G094900 [exp] 61 / 5e-11 AT1G13110 268 / 4e-84 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) Potri.008G223500 [exp] 58 / 4e-10 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.001G365001 [exp] 54 / 2e-09 AT2G24180 121 / 3e-33 cytochrome p450 71b6 (.1) Potri.007G074300 [exp] 55 / 5e-09 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.015G086000 [exp] 54 / 1e-08 AT1G13080 434 / 2e-148 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) Potri.001G364600 [exp] 53 / 2e-08 AT5G25120 352 / 2e-116 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018261 pacid=23179398 polypeptide=Lus10018261 locus=Lus10018261.g ID=Lus10018261.BGIv1.0 annot-version=v1.0 ATGGTGGTGACATTGTTTCAGCAGCTGATTTCTTCTTCCTCCTTAATCCCAGTATTTCTCTTCACTTCCACAATCATCATCCTTGTCTCTTTATTCCTCA TCCTCAAGAATCACCTGCCGTGCAACAAACGCGCCGCTCCAAATCAGCCGCTGCCAGAGCCATGGAAGCTCCCAGTAATTGGAAACCTCCACCAACTCAT CGGCGACGATCCTCGCCGTAGACTCAAACACTTAGCACAAAAGTACGGTCCAGATCTTATGCAAATCAGGGAGGAAGAGGTCAAGGGTTTTGTCGACCGG ATTGCTAGTTGTAAAGCACGGGAAGTTGTGGATCTGAGCGAGATAGTGGAGAAATGGACTAGTTCGGTGACTTCAAGGGCGGCGTTTGGGAAAGTGCAGG AGCTGGGGAATGAGTTTGTGATGGTGGTTGCTAAGATCTCGGAAGTTGTTTCGGGATTTCAGGTATCTGATTTGTACCCTTCTCTGAAATTCCTGCCTGT ACTCGATATTGGACAAGATCATTGA
AA sequence Show only first row Show all	>Lus10018261 pacid=23179398 polypeptide=Lus10018261 locus=Lus10018261.g ID=Lus10018261.BGIv1.0 annot-version=v1.0 MVVTLFQQLISSSSLIPVFLFTSTIIILVSLFLILKNHLPCNKRAAPNQPLPEPWKLPVIGNLHQLIGDDPRRRLKHLAQKYGPDLMQIREEEVKGFVDR IASCKAREVVDLSEIVEKWTSSVTSRAAFGKVQELGNEFVMVVAKISEVVSGFQVSDLYPSLKFLPVLDIGQDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26170		CYP71B19	"cytochrome P450, family 71, s...		Lus10018261 [exp]	0	1
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10018262 [exp]	1.0	0.9831
AT5G03890			unknown protein		Lus10015117 [exp]	2.0	0.9711
AT2G16750			Protein kinase protein with ad...		Lus10014122 [exp]	2.4	0.9689
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10006835 [exp]	2.8	0.9752
AT1G70830		MLP28	MLP-like protein 28 (.1.2.3.4....		Lus10020498 [exp]	3.2	0.9705
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10032745 [exp]	3.9	0.9744
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10025749 [exp]	4.5	0.9568
AT2G37740	C2H2ZnF	ATZFP10, ZFP10	zinc-finger protein 10 (.1)		Lus10021490 [exp]	4.5	0.9612
AT2G22850	bZIP	ATBZIP6	basic leucine-zipper 6 (.1.2)		Lus10019273 [exp]	4.9	0.9540
AT5G19970			unknown protein		Lus10019451 [exp]	5.2	0.9533

Compare expression of checked genes

Lus10018261 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.