Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26210 125 / 3e-34 CYP71B23 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) AT3G26270 123 / 1e-33 CYP71B25 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1) AT1G13080 121 / 2e-33 CYP71B2 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) AT3G26230 119 / 3e-32 CYP71B24 "cytochrome P450, family 71, subfamily B, polypeptide 24", cytochrome P450, family 71, subfamily B, polypeptide 24 (.1) AT3G26830 117 / 2e-31 CYP71B15, PAD3 PHYTOALEXIN DEFICIENT 3, Cytochrome P450 superfamily protein (.1) AT1G13090 116 / 4e-31 CYP71B28 "cytochrome P450, family 71, subfamily B, polypeptide 28", cytochrome P450, family 71, subfamily B, polypeptide 28 (.1) AT3G26280 116 / 6e-31 CYP71B4 "cytochrome P450, family 71, subfamily B, polypeptide 4", cytochrome P450, family 71, subfamily B, polypeptide 4 (.1) AT1G13110 112 / 1e-29 CYP71B7 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) AT5G25140 112 / 2e-29 CYP71B13 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) AT3G26180 109 / 3e-29 CYP71B20 "cytochrome P450, family 71, subfamily B, polypeptide 20", cytochrome P450, family 71, subfamily B, polypeptide 20 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018263 [exp] 221 / 1e-70 AT5G25140 393 / 5e-132 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) Lus10027427 [exp] 180 / 3e-56 AT3G26270 266 / 4e-85 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1) Lus10026252 [exp] 161 / 2e-46 AT5G25120 383 / 2e-123 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10002885 [exp] 156 / 1e-45 AT3G48280 396 / 2e-133 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10012767 [exp] 154 / 3e-45 AT3G26210 386 / 1e-129 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10042419 [exp] 150 / 4e-44 AT3G48280 343 / 3e-114 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10013194 [exp] 149 / 6e-43 AT5G25120 387 / 9e-130 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10030708 [exp] 148 / 1e-42 AT3G26210 390 / 6e-131 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10016601 [exp] 142 / 1e-40 AT3G26320 402 / 6e-136 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G075000 [exp] 147 / 1e-42 AT3G26300 386 / 2e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074900 [exp] 145 / 9e-42 AT3G26300 383 / 3e-128 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074850 [exp] 142 / 2e-40 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.001G364900 [exp] 133 / 2e-38 AT3G26300 228 / 1e-70 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G131001 [exp] 132 / 2e-38 AT3G26230 230 / 4e-72 "cytochrome P450, family 71, subfamily B, polypeptide 24", cytochrome P450, family 71, subfamily B, polypeptide 24 (.1) Potri.007G074300 [exp] 136 / 3e-38 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.012G090000 [exp] 135 / 3e-38 AT3G26330 433 / 5e-148 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Potri.012G089900 [exp] 135 / 7e-38 AT3G48280 429 / 1e-146 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.015G086000 [exp] 135 / 8e-38 AT1G13080 434 / 2e-148 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) Potri.008G223500 [exp] 132 / 5e-37 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10018262 pacid=23179317 polypeptide=Lus10018262 locus=Lus10018262.g ID=Lus10018262.BGIv1.0 annot-version=v1.0 ATGGATGTTCTTCTGGATATTCAGAAAAATTGTACCCTTGGTGTTCCTCTAACTGTTGAAGTTGTAAAAGCTGTCACTCTGGAATTGTTCTTCGTTGGAA TTGGGACATCATTAATAATAATATTGTGGATTATGTCAGAAATGATTAAAAATTTGAGAGTGATGCAAATAGCACAACAAAAAGGAAGACAAGTATTTAG CAAGATGAAAAATGTCGTCGAGGAGGCAAATCTTCATAAGTTAAACTATTTAGATATGATGATCGCAGGAACTCTAAGGTTGCACTCATCTGTTCCTTTA CTGGTTCTTAGAGAAACTACAAAGAATGTGAAGCTTGATAATGGATACGAGGTGCCAATGAGAACGAGAGTATTTGTGAATGTTTGGGCAATCAATCGAG ATTCTTGTTATTGGACTGATGCGGAAATGTTTCATCTTGAAAGATTCGTGGATTATTCAGTTGGCTTCAATTGA
AA sequence Show only first row Show all	>Lus10018262 pacid=23179317 polypeptide=Lus10018262 locus=Lus10018262.g ID=Lus10018262.BGIv1.0 annot-version=v1.0 MDVLLDIQKNCTLGVPLTVEVVKAVTLELFFVGIGTSLIIILWIMSEMIKNLRVMQIAQQKGRQVFSKMKNVVEEANLHKLNYLDMMIAGTLRLHSSVPL LVLRETTKNVKLDNGYEVPMRTRVFVNVWAINRDSCYWTDAEMFHLERFVDYSVGFN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10018262 [exp]	0	1
AT3G26170		CYP71B19	"cytochrome P450, family 71, s...		Lus10018261 [exp]	1.0	0.9831
AT2G36890	MYB	BIT1, ATMYB38, ...	REGULATOR OF AXILLARY MERISTEM...		Lus10023002 [exp]	2.2	0.9602
AT5G03890			unknown protein		Lus10015117 [exp]	2.4	0.9645
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10036168 [exp]	4.0	0.9507
AT1G56010	NAC	NAC1, ANAC021, ...	Arabidopsis NAC domain contain...		Lus10042466 [exp]	4.2	0.9535
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10006835 [exp]	4.2	0.9649
					Lus10042813 [exp]	4.9	0.9472
AT1G70830		MLP28	MLP-like protein 28 (.1.2.3.4....		Lus10020498 [exp]	5.3	0.9634
AT1G32640	bHLH	JIN1, JAI1, ZBF...	JASMONATE INSENSITIVE 1, Basic...		Lus10005999 [exp]	5.5	0.9389
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10020359 [exp]	6.5	0.9465

Compare expression of checked genes

Lus10018262 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.