Lus10018265 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16860 194 / 1e-57 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39350 192 / 1e-57 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G16835 187 / 5e-56 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18750 189 / 6e-56 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G13600 186 / 4e-55 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G18485 187 / 8e-55 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G24000 184 / 1e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G66520 182 / 2e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G03880 181 / 7e-54 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 182 / 2e-53 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040648 366 / 4e-125 AT4G18750 376 / 1e-119 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10035788 206 / 6e-62 AT3G16610 636 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10037362 203 / 1e-61 AT3G57430 477 / 9e-158 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028593 190 / 1e-56 AT5G16860 879 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031989 188 / 7e-56 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018897 190 / 8e-56 AT5G16860 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006628 181 / 1e-55 AT4G21065 399 / 7e-137 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10005987 183 / 2e-55 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030225 179 / 3e-55 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G152300 260 / 4e-83 AT4G33990 489 / 1e-162 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G237000 195 / 4e-59 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G005700 196 / 6e-59 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G121400 190 / 1e-57 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G059400 192 / 6e-57 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.015G047600 192 / 8e-57 AT1G18485 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G006400 190 / 9e-57 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G005400 189 / 1e-56 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G041200 191 / 2e-56 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G048800 190 / 2e-56 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10018265 pacid=23179272 polypeptide=Lus10018265 locus=Lus10018265.g ID=Lus10018265.BGIv1.0 annot-version=v1.0
ATGTTTAACAGCATATTGGTTAAGGACTTGACAGCTTGGAGCTCCATGATTAACGGATACGCGATTCACGGGATGGGAAATGAAGCTCTCGGTTTATTCC
ACGAGATGCGAAAAGAAGGGATAGTGCCGGATAGTGTTACTTACACGAGTGTATTACTTGCGTGTAGTCATTCGGGACTCGTTGAGGATGGAGTGAATTA
TTTTCTGAGCATGCAGAAGGATTTCGGAATTGAACCTGGGATAGAACACTATACCTGCTTGGTAGATCTTCTTGGGAGAGCTGGTCGGCTCGACTTGGCG
ATGAAACCGACGTTGGAAATGCCCGGAGAGATTCAAGCGCGAATGTGGCCTTCGATTCTGAGTTCGTGCAGGAAATATCAAAATGTAGAGCTGGGCGAAT
GTGCTGCTAAGAAGCTGTTAGAACTGAGTCCTGATCAGACTGGGAATTATGTTCTGATGGCTAATCTGTACATGTCAGAAGGTAAGTGGAAGGAGGCTGC
CAAGATGAGAAGCTCGATGGATGGTCGAGGATTAGTAAAGAAACCTGCTTGGAGCCAGGTCGAGATTAATGGTTCGGTCAACGACTCCATTGCCAGAGTT
GGATGA
AA sequence
>Lus10018265 pacid=23179272 polypeptide=Lus10018265 locus=Lus10018265.g ID=Lus10018265.BGIv1.0 annot-version=v1.0
MFNSILVKDLTAWSSMINGYAIHGMGNEALGLFHEMRKEGIVPDSVTYTSVLLACSHSGLVEDGVNYFLSMQKDFGIEPGIEHYTCLVDLLGRAGRLDLA
MKPTLEMPGEIQARMWPSILSSCRKYQNVELGECAAKKLLELSPDQTGNYVLMANLYMSEGKWKEAAKMRSSMDGRGLVKKPAWSQVEINGSVNDSIARV
G

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16860 Tetratricopeptide repeat (TPR)... Lus10018265 0 1
AT2G42280 bHLH bHLH130 basic helix-loop-helix (bHLH) ... Lus10037484 25.8 0.7733
AT4G28320 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl ... Lus10039719 35.6 0.7715
AT1G30800 Fasciclin-like arabinogalactan... Lus10038414 35.9 0.7515
AT3G52420 ATOEP7 outer envelope membrane protei... Lus10003733 47.1 0.7519
AT3G02100 UDP-Glycosyltransferase superf... Lus10003454 57.2 0.7395
AT2G28305 ATLOG1 LONELY GUY 1, Putative lysine ... Lus10016096 58.0 0.7500
AT2G28085 SAUR-like auxin-responsive pro... Lus10016129 58.2 0.7429
Lus10011950 109.4 0.7129
Lus10018536 122.6 0.7134
AT2G47770 ATTSPO TSPO(outer membrane tryptophan... Lus10010281 132.6 0.7142

Lus10018265 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.