Lus10018269 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12830 92 / 7e-24 SAUR-like auxin-responsive protein family (.1)
AT1G56150 91 / 1e-23 SAUR-like auxin-responsive protein family (.1)
AT1G16510 91 / 2e-23 SAUR-like auxin-responsive protein family (.1)
AT1G79130 86 / 1e-21 SAUR-like auxin-responsive protein family (.1)
AT3G61900 59 / 3e-11 SAUR-like auxin-responsive protein family (.1)
AT5G42410 57 / 1e-10 SAUR-like auxin-responsive protein family (.1)
AT4G22620 57 / 4e-10 SAUR-like auxin-responsive protein family (.1)
AT2G46690 56 / 5e-10 SAUR-like auxin-responsive protein family (.1)
AT1G43040 55 / 6e-10 SAUR-like auxin-responsive protein family (.1)
AT1G19840 56 / 8e-10 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040643 257 / 2e-88 AT1G16510 91 / 8e-24 SAUR-like auxin-responsive protein family (.1)
Lus10031754 87 / 2e-21 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1)
Lus10031178 79 / 2e-18 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Lus10012426 59 / 4e-11 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10042374 57 / 2e-10 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10012190 57 / 3e-10 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10026297 57 / 3e-10 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10026977 57 / 4e-10 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10001397 55 / 1e-09 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G096400 86 / 2e-21 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1)
Potri.007G067800 84 / 2e-20 AT3G12830 148 / 5e-47 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 67 / 1e-13 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 60 / 2e-11 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 59 / 4e-11 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.002G057500 57 / 7e-11 AT3G12830 64 / 2e-14 SAUR-like auxin-responsive protein family (.1)
Potri.002G000600 56 / 4e-10 AT1G43040 113 / 2e-33 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 55 / 7e-10 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.009G125900 55 / 1e-09 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 54 / 1e-09 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10018269 pacid=23179298 polypeptide=Lus10018269 locus=Lus10018269.g ID=Lus10018269.BGIv1.0 annot-version=v1.0
ATGAAGAAACTGTTCCGGACCCTCTCTGACAAGGTCCGTAAAATTAGCACCGGAAGAATGAGCTCCTCCGCCAGGGTCGGCGGCGGCTACTCCGTCCTCC
GGCGTACCAGCTCCGATTCCGAGCTCCGGCAAAGGAGGATGAGGGGTAAGAACAAACTGGCCCAGCTGCTGCAGATGAGGCTCGGGAAGAAGAGATCGGC
GGCGAGAGTTCCGGCTGGTCATTTCCCAGTTCAGGTAGGGAGCGATCAGGAGGCGGCGGAGACGTTTGTGGTAAGCGCCAAGCTGTTAAGGCACCCGGTG
TTTGTGAACCTGCTGAAGATATCGGCGGCGGAGTTTGGGTACGGGCAGAGCGGCGTGCTGAGGATCCCAGTTCGGGTGATGGTTTTCGAGCGGGTTATGG
AGCTGATTCGGTTGACGTCCAAGCTGTTAAGCCACCCGGTGTTTGTGAACCTGCGGAAGATATCGGCGGCGGAGTTTGGGTACGGGCAGAGCGGCGTGCT
GAGGATCCCAGTTCGGGTGATGGTTTTCGAGCGGGTTATGGAGCTGATTCGGTTGACCAAGGACCCGGGTGAAGTGGTTGATTGGGACGAGGATTTCAAC
GTGTGCAACTCACTTATTGACTAG
AA sequence
>Lus10018269 pacid=23179298 polypeptide=Lus10018269 locus=Lus10018269.g ID=Lus10018269.BGIv1.0 annot-version=v1.0
MKKLFRTLSDKVRKISTGRMSSSARVGGGYSVLRRTSSDSELRQRRMRGKNKLAQLLQMRLGKKRSAARVPAGHFPVQVGSDQEAAETFVVSAKLLRHPV
FVNLLKISAAEFGYGQSGVLRIPVRVMVFERVMELIRLTSKLLSHPVFVNLRKISAAEFGYGQSGVLRIPVRVMVFERVMELIRLTKDPGEVVDWDEDFN
VCNSLID

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16510 SAUR-like auxin-responsive pro... Lus10018269 0 1
AT5G65230 MYB ATMYB53 myb domain protein 53 (.1) Lus10039735 1.0 0.9793
AT3G29810 COBL2 COBRA-like protein 2 precursor... Lus10042386 10.0 0.9013
AT5G11100 SYT4, NTMCTYPE2... synaptotagmin 4, Calcium-depen... Lus10039979 18.2 0.9111
AT5G16023 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 ... Lus10034071 28.2 0.9059
AT5G16023 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 ... Lus10003079 31.9 0.9024
AT4G35150 O-methyltransferase family pro... Lus10017699 40.8 0.8973
Lus10032770 43.5 0.8888
AT4G15480 UGT84A1 UDP-Glycosyltransferase superf... Lus10027862 44.6 0.8943
AT5G47540 Mo25 family protein (.1) Lus10036523 46.6 0.8923
Lus10002921 48.1 0.8882

Lus10018269 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.