Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07200 50 / 3e-08 RING/U-box superfamily protein (.1.2) AT5G48655 47 / 7e-07 RING/U-box superfamily protein (.1.2.3) AT1G19310 44 / 1e-05 RING/U-box superfamily protein (.1) AT1G18660 42 / 4e-05 zinc finger (C3HC4-type RING finger) family protein (.1), zinc finger (C3HC4-type RING finger) family protein (.2), zinc finger (C3HC4-type RING finger) family protein (.3), zinc finger (C3HC4-type RING finger) family protein (.4) AT1G74990 40 / 0.0001 RING/U-box superfamily protein (.1) AT1G50410 40 / 0.0002 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1) AT1G61140 40 / 0.0003 EDA16 embryo sac development arrest 16, SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1.2.3) AT2G23780 39 / 0.0004 RING/U-box superfamily protein (.1) AT2G26350 39 / 0.0005 PEX10, ATPEX10 peroxin 10 (.1) AT5G01960 39 / 0.0006 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040641 [exp] 203 / 1e-68 AT3G07200 46 / 1e-06 RING/U-box superfamily protein (.1.2) Lus10022569 [exp] 52 / 8e-09 AT3G07200 81 / 3e-19 RING/U-box superfamily protein (.1.2) Lus10022774 [exp] 49 / 1e-07 AT5G48655 153 / 7e-47 RING/U-box superfamily protein (.1.2.3) Lus10010791 [exp] 47 / 7e-07 AT1G19310 266 / 1e-90 RING/U-box superfamily protein (.1) Lus10016303 [exp] 47 / 8e-07 AT1G19310 268 / 2e-91 RING/U-box superfamily protein (.1) Lus10019075 [exp] 43 / 4e-05 AT1G18660 583 / 0.0 zinc finger (C3HC4-type RING finger) family protein (.1), zinc finger (C3HC4-type RING finger) family protein (.2), zinc finger (C3HC4-type RING finger) family protein (.3), zinc finger (C3HC4-type RING finger) family protein (.4) Lus10020007 [exp] 42 / 4e-05 AT2G26350 449 / 2e-158 peroxin 10 (.1) Lus10022492 [exp] 42 / 5e-05 AT2G23780 241 / 1e-80 RING/U-box superfamily protein (.1) Lus10016796 [exp] 42 / 6e-05 AT2G23780 242 / 3e-81 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G082200 [exp] 55 / 8e-10 AT3G07200 86 / 2e-20 RING/U-box superfamily protein (.1.2) Potri.014G191400 [exp] 51 / 2e-08 AT5G48655 158 / 8e-49 RING/U-box superfamily protein (.1.2.3) Potri.003G148300 [exp] 51 / 2e-08 AT5G48655 77 / 6e-17 RING/U-box superfamily protein (.1.2.3) Potri.002G245500 [exp] 50 / 6e-08 AT5G48655 154 / 2e-47 RING/U-box superfamily protein (.1.2.3) Potri.014G040400 [exp] 47 / 7e-07 AT1G19310 226 / 4e-75 RING/U-box superfamily protein (.1) Potri.002G133000 [exp] 47 / 9e-07 AT1G19310 244 / 5e-82 RING/U-box superfamily protein (.1) Potri.007G031600 [exp] 43 / 2e-05 AT2G23780 227 / 4e-75 RING/U-box superfamily protein (.1) Potri.005G127900 [exp] 42 / 3e-05 AT2G23780 234 / 3e-78 RING/U-box superfamily protein (.1) Potri.012G068100 [exp] 41 / 0.0001 AT1G18660 679 / 0.0 zinc finger (C3HC4-type RING finger) family protein (.1), zinc finger (C3HC4-type RING finger) family protein (.2), zinc finger (C3HC4-type RING finger) family protein (.3), zinc finger (C3HC4-type RING finger) family protein (.4) Potri.016G033800 [exp] 40 / 0.0002 AT5G05130 650 / 0.0 DNA/RNA helicase protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018271 pacid=23179401 polypeptide=Lus10018271 locus=Lus10018271.g ID=Lus10018271.BGIv1.0 annot-version=v1.0 ATGAGCAGTCCTCCCCCACCGAGTCCAACCAATGCTCACAATTGCTCGCCTGAGCAGGAAACCAACAATGGTGGCGATGCTAGTACTGATCGTGTTATTG GTGAAGCTGCAGAAATACTGCACAACTTTGGTACTGCAGCTGCTGGTGGTCATCGTGGTGTAGCGCCTGTTGTTGCCGAACCAGATGATGATGTGGTGGT GGAAGTGAATGCTGCTGATCGAGTGGGGGCGGGTGTACAGAGGTTAAGGTGTGCGATATGCAGGGGGGACAGGTTGAGGGATCCGATGGCGACGATGTGC GGGCATGTGTTCTGCAGGATCTGCATTCTGAATGCTCTCACCTGGAATAGGATCTGCCCTACTTGCAGGGCCCGTATCCGCGGCGGCGAACGTGCCCTTT TGAGGATCTACCTTTCCTAG
AA sequence Show only first row Show all	>Lus10018271 pacid=23179401 polypeptide=Lus10018271 locus=Lus10018271.g ID=Lus10018271.BGIv1.0 annot-version=v1.0 MSSPPPPSPTNAHNCSPEQETNNGGDASTDRVIGEAAEILHNFGTAAAGGHRGVAPVVAEPDDDVVVEVNAADRVGAGVQRLRCAICRGDRLRDPMATMC GHVFCRICILNALTWNRICPTCRARIRGGERALLRIYLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07200			RING/U-box superfamily protein...		Lus10018271 [exp]	0	1
AT2G31500		CPK24	calcium-dependent protein kina...		Lus10025570 [exp]	2.6	0.7389
AT1G13560		AAPT1, ATAAPT1	aminoalcoholphosphotransferase...		Lus10002042 [exp]	12.0	0.6112
AT1G17810		BETA-TIP	beta-tonoplast intrinsic prote...		Lus10040652 [exp]	13.3	0.7048
AT2G25770			Polyketide cyclase/dehydrase a...		Lus10026898 [exp]	13.7	0.5579
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10002612 [exp]	15.9	0.6359
AT1G71140			MATE efflux family protein (.1...		Lus10008911 [exp]	19.5	0.6894
AT3G16720		ATL2	TOXICOS EN LEVADURA 2 (.1)		Lus10042277 [exp]	19.6	0.6774
AT4G02210			unknown protein		Lus10008312 [exp]	20.0	0.6606
AT4G18360			Aldolase-type TIM barrel famil...		Lus10042495 [exp]	21.9	0.6264
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10017278 [exp]	23.2	0.6047

Compare expression of checked genes

Lus10018271 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.