Lus10018274 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60330 80 / 1e-19 unknown protein
AT3G45320 79 / 5e-19 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10018274 pacid=23179296 polypeptide=Lus10018274 locus=Lus10018274.g ID=Lus10018274.BGIv1.0 annot-version=v1.0
ATGGCGGCCAAAGACGGCTACAGACTCCGTTCAATCCTAGTACATTCCCTCTGGATGACAATCCTCGGCGTCCTCCTGTTCCGGCTAGCCACCGCCAGCT
CCCAGAGGCTGGTATTCGTCGAGATATTCACAATCTCCGGTGCGGTACTGGCAACCGCTCCCTGGATTTTCCAGCTCCTGGCTTCCACCGCCATCGCAGT
GTTGTACAATGCGCAAGTCTGCGGTTTCACTTGGCTCTTGCAGTCAGGTGATCCTCTGTCGGATGAAGTCGAGGATCCGGAACGAGTATTTGGATTCGAT
TTCGTCCGTGGTGGTGGGAATGCGTATCGTGAGAAGGGAGATGACAAGATTAAGTACCATGTTCGTCTATGGCGAGATTCGGAATCGGCCTCTAAAACTG
CTCCTTGTCTGCAAAGAAATAGAACCGTTTGA
AA sequence
>Lus10018274 pacid=23179296 polypeptide=Lus10018274 locus=Lus10018274.g ID=Lus10018274.BGIv1.0 annot-version=v1.0
MAAKDGYRLRSILVHSLWMTILGVLLFRLATASSQRLVFVEIFTISGAVLATAPWIFQLLASTAIAVLYNAQVCGFTWLLQSGDPLSDEVEDPERVFGFD
FVRGGGNAYREKGDDKIKYHVRLWRDSESASKTAPCLQRNRTV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60330 unknown protein Lus10018274 0 1
AT5G49340 TBL4 TRICHOME BIREFRINGENCE-LIKE 4 ... Lus10037726 1.7 0.9970
AT3G12160 AtRABA4d ARABIDOPSIS THALIANA RAB GTPAS... Lus10016284 2.4 0.9962
AT1G22130 MADS AGL104 AGAMOUS-like 104 (.1) Lus10022506 2.6 0.9852
AT4G03010 RNI-like superfamily protein (... Lus10033744 3.0 0.9849
AT2G28085 SAUR-like auxin-responsive pro... Lus10021435 3.0 0.9957
AT4G28110 MYB ATMYB41 myb domain protein 41 (.1) Lus10033738 3.5 0.9884
AT1G53903 Protein of unknown function (D... Lus10003939 4.7 0.9804
Lus10032468 4.8 0.9789
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008935 4.9 0.9849
AT4G28110 MYB ATMYB41 myb domain protein 41 (.1) Lus10031607 8.4 0.9876

Lus10018274 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.