Lus10018276 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02910 142 / 4e-41 AIG2-like (avirulence induced gene) family protein (.1)
AT1G80245 117 / 3e-32 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
AT4G00695 110 / 1e-29 unknown protein
AT5G46720 105 / 4e-27 AIG2-like (avirulence induced gene) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040637 208 / 7e-68 AT1G80245 116 / 9e-35 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
Lus10040635 208 / 1e-67 AT3G02910 135 / 4e-41 AIG2-like (avirulence induced gene) family protein (.1)
Lus10042425 191 / 9e-61 AT1G80245 108 / 2e-31 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
Lus10018344 174 / 1e-54 AT1G80245 86 / 5e-23 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
Lus10034712 151 / 7e-45 AT5G46720 159 / 3e-50 AIG2-like (avirulence induced gene) family protein (.1)
Lus10026245 117 / 1e-32 ND 48 / 3e-08
Lus10040471 0 / 1 ND 52 / 1e-26
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G041100 206 / 2e-66 AT3G02910 220 / 7e-74 AIG2-like (avirulence induced gene) family protein (.1)
Potri.003G149100 114 / 3e-31 AT1G80245 91 / 3e-24 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
Potri.003G092600 113 / 5e-30 AT5G46720 144 / 8e-44 AIG2-like (avirulence induced gene) family protein (.1)
Potri.001G081300 99 / 2e-25 AT1G80245 80 / 5e-20 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0278 AIG2 PF06094 GGACT Gamma-glutamyl cyclotransferase, AIG2-like
Representative CDS sequence
>Lus10018276 pacid=23179373 polypeptide=Lus10018276 locus=Lus10018276.g ID=Lus10018276.BGIv1.0 annot-version=v1.0
ATGGGCGTCGGCGAAAGAAGGGAGAACCGCCAGCACCCGGCGGCGGTGATTTTCACATACGGCACTCTGAAGAAGGGCTTCTCCAATCACCGCTTGCTGC
AAGATCTGATGCAGACAGGAGACGCAGTCTTCCGATGCAATTGCCGAACCGTCGACGCCTTCCCTCTCGTTTGTGGTCCTTACCGTGTACCTTTCCTCCT
CAACCTTCCCGGAGCTGACGGAGCCAATCGAGTCTCCGGCGAGATGTACGCCGTCTCTGACCCCGTCTCGGCGCGTGTTCCCGCCCGCCTGGACGAGCTT
GAAGGCCCCTCCACCGGCCATTACGAGCGGTTGCCGATTGAGGTGGAGCCTGCGGACGGTGGAGAAGAGGAGATCGAGTCTGTGGAGGCATATTTCGCGG
AGAGGAGCTACGCGGTGGATATGTGGGAGAAGAGCGGGAAGATCGGGTATTCCGTGTACGGAGAGAAGGAATCGAAAGGATACCCAAAAAGCCGGTCGAC
CCAGTTACATACAAACCGACTAAAGCCCGGCCCAGAACCCGCTTTTAATTTCAACCCGAGTTTGTTCGATGCAGCTTTCCTCGAGTTTAGGCCGTCAATC
TCCGCAGAGATTCAGGAAAATCTACGATTTCCCGCCCTGGATGACGTAAACAAGCTTATAGAGAACAGCAGGATTGACGATGTACAGTGGCTCTGTTCCC
TGTCCGAGTCTGAGCTTGACGTCCTGATCAGCTTGAAGAATCTGGTGATTCGGCGGGCTAACGCTATTGGTCATGAGGAACTCGCCGACAAATTTAACTT
AAAGTTGCTCCGAGCACTTGGACTAGTTGTCATGGAGCATTTCAGAGAAAAGGTGAAGGGTTTGCCAACAGTACCTGGGATGGACAAATGCACTGCATAT
ATAGATGGTTGCAACTTGCTAAAGTCTAAGATTGGGGATAACTTAAGCATTGAAGAGTTGAAGTCTCATCTTAAAAGACCAAGTAAAAGGTAG
AA sequence
>Lus10018276 pacid=23179373 polypeptide=Lus10018276 locus=Lus10018276.g ID=Lus10018276.BGIv1.0 annot-version=v1.0
MGVGERRENRQHPAAVIFTYGTLKKGFSNHRLLQDLMQTGDAVFRCNCRTVDAFPLVCGPYRVPFLLNLPGADGANRVSGEMYAVSDPVSARVPARLDEL
EGPSTGHYERLPIEVEPADGGEEEIESVEAYFAERSYAVDMWEKSGKIGYSVYGEKESKGYPKSRSTQLHTNRLKPGPEPAFNFNPSLFDAAFLEFRPSI
SAEIQENLRFPALDDVNKLIENSRIDDVQWLCSLSESELDVLISLKNLVIRRANAIGHEELADKFNLKLLRALGLVVMEHFREKVKGLPTVPGMDKCTAY
IDGCNLLKSKIGDNLSIEELKSHLKRPSKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02910 AIG2-like (avirulence induced ... Lus10018276 0 1
Lus10038116 4.6 0.8013
AT4G14430 PEC12, IBR10, E... DELTA\(3\), DELTA\(2\)-ENOYL C... Lus10022199 5.3 0.8270
AT5G28040 GeBP DNA-binding storekeeper protei... Lus10004121 7.2 0.8125
AT1G07890 ATAPX01, CS1, A... maternal effect embryo arrest ... Lus10015970 8.7 0.8080
AT2G16710 Iron-sulphur cluster biosynthe... Lus10021368 8.9 0.7520
AT5G10750 Protein of unknown function (D... Lus10042428 9.8 0.8068
AT3G02910 AIG2-like (avirulence induced ... Lus10040635 14.5 0.7917
AT5G43190 Galactose oxidase/kelch repeat... Lus10010610 14.6 0.7404
AT1G80180 unknown protein Lus10014488 14.7 0.8010
AT3G48090 ATEDS1, EDS1 enhanced disease susceptibilit... Lus10036644 18.2 0.7986

Lus10018276 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.