Lus10018279 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28460 73 / 2e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G61520 73 / 2e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G31850 55 / 2e-08 PGR3 proton gradient regulation 3 (.1)
AT1G02060 54 / 4e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G07290 53 / 8e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 52 / 2e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G51965 52 / 2e-07 ABO5 ABA Overly-Sensitive 5 (.1)
AT5G18390 52 / 2e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G59900 51 / 4e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G52640 50 / 4e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040633 170 / 3e-48 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014660 60 / 6e-10 AT3G04760 522 / 3e-180 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10000554 59 / 8e-10 AT3G04760 535 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10021989 59 / 1e-09 AT5G65560 498 / 2e-157 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042529 56 / 1e-08 AT5G65560 498 / 1e-160 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026191 55 / 2e-08 AT3G14580 391 / 2e-134 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10023650 55 / 3e-08 AT5G21222 623 / 0.0 protein kinase family protein (.1)
Lus10034924 54 / 5e-08 AT5G21222 599 / 0.0 protein kinase family protein (.1)
Lus10037968 54 / 7e-08 AT5G55840 1131 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G090400 103 / 5e-25 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G379500 62 / 7e-11 AT3G14580 442 / 2e-154 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.015G105400 56 / 8e-09 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G105000 54 / 3e-08 AT1G51965 855 / 0.0 ABA Overly-Sensitive 5 (.1)
Potri.010G241300 52 / 1e-07 AT5G04810 1230 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.013G034200 52 / 1e-07 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.003G204100 52 / 1e-07 AT1G07740 502 / 2e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G017400 52 / 1e-07 AT5G04810 1278 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.006G264800 50 / 6e-07 AT4G31850 1428 / 0.0 proton gradient regulation 3 (.1)
Potri.007G134300 49 / 6e-07 AT5G09320 114 / 1e-28 Vacuolar sorting protein 9 (VPS9) domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10018279 pacid=23179355 polypeptide=Lus10018279 locus=Lus10018279.g ID=Lus10018279.BGIv1.0 annot-version=v1.0
ATGGCCGATTTCGTTGATGAAATCCATGAAAACGACTATGGTGGTATAGCAGGCAGCAAATGGATGACCGGAGCTTACGTGGCTGTCCGGAGGTCCGCAA
AGGTTGATCGATGCCGTTGCTGGAGGCTATCTTGCGCACCTAGAGCTTCTGCTGAAGCCTGCAAGCGAATGGGACGTCGCAAAACTCAGCCGAATCCTCT
TCTCCAATGCATTCTCCTCTTCCCCTTTCTTTCTCTTCAAAATCACCCGCCGATTGCCGTCTTCTACTTCAGCTCTCCATTTCTGCAATTCCTCCGGAAA
AACAATTCACCGTCGTCTCTGGATCCCCAGTCTCTCTCTCACCCATTTCAAGCCGTCTTTGAGCTTGCTAGCAAGGAAGCTAATTCGGTCGAGAGCCTCT
CTCAAGTTTATAAAGCTTCCGAAGAGTTGGGAATCCAACTCACGGCCAATTCGGCTGCCATTCTCCTTCGCTGCCTCGGAAGAAACGGGATGATGACTGA
TGCTAAGTTCTTCTATGATAGCTTTGATGATTCAGATGTGAAGCCAACTGCTAACACATTCAATGCATTGTTTAGAGGCTTAAGGGAGAATAAGTTAGTT
GATAAAGCTTTTGAGTTGATGGATAGAATGATCAAGGAGGGTTGTAACCCTGATTTCATCACGATGGAGATCCTCACGGAGTGGCTTTCTGCTGTTGGTG
AAACGGATAAGTTGAGAAGATTTGTTGAAGGCTATCCTGTCTCAGGTGCTGCTGAACTAACATCAGCTGCTGCTTAA
AA sequence
>Lus10018279 pacid=23179355 polypeptide=Lus10018279 locus=Lus10018279.g ID=Lus10018279.BGIv1.0 annot-version=v1.0
MADFVDEIHENDYGGIAGSKWMTGAYVAVRRSAKVDRCRCWRLSCAPRASAEACKRMGRRKTQPNPLLQCILLFPFLSLQNHPPIAVFYFSSPFLQFLRK
NNSPSSLDPQSLSHPFQAVFELASKEANSVESLSQVYKASEELGIQLTANSAAILLRCLGRNGMMTDAKFFYDSFDDSDVKPTANTFNALFRGLRENKLV
DKAFELMDRMIKEGCNPDFITMEILTEWLSAVGETDKLRRFVEGYPVSGAAELTSAAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28460 Pentatricopeptide repeat (PPR)... Lus10018279 0 1
AT1G79220 Mitochondrial transcription te... Lus10031762 3.0 0.8671
AT1G69350 Tetratricopeptide repeat (TPR)... Lus10030415 4.5 0.8669
AT5G66500 Tetratricopeptide repeat (TPR)... Lus10041770 6.3 0.8457
AT3G21630 LYSMRLK1, CERK1 LYSM DOMAIN RECEPTOR-LIKE KINA... Lus10016793 9.3 0.7584
AT1G13410 Tetratricopeptide repeat (TPR)... Lus10017243 10.2 0.8153
AT3G02010 Pentatricopeptide repeat (PPR)... Lus10035164 10.4 0.8395
AT4G32430 Pentatricopeptide repeat (PPR)... Lus10017032 10.4 0.8470
AT5G47460 Pentatricopeptide repeat (PPR)... Lus10028953 12.6 0.7989
AT5G27110 Tetratricopeptide repeat (TPR)... Lus10009702 13.2 0.7864
AT3G16610 pentatricopeptide (PPR) repeat... Lus10035788 13.5 0.8380

Lus10018279 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.