Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19640 332 / 2e-117 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT5G45130 331 / 3e-117 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT3G54840 211 / 8e-70 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT1G06400 150 / 1e-45 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT5G45750 150 / 1e-45 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18800 149 / 4e-45 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT1G16920 149 / 4e-45 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT4G18430 146 / 4e-44 AtRABA1e RAB GTPase homolog A1E (.1) AT5G60860 146 / 6e-44 AtRABA1f RAB GTPase homolog A1F (.1) AT3G15060 145 / 7e-44 AtRABA1g RAB GTPase homolog A1G (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040625 [exp] 372 / 2e-133 AT5G45130 355 / 6e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10038334 [exp] 335 / 2e-118 AT5G45130 349 / 3e-124 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10034903 [exp] 229 / 1e-76 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10036196 [exp] 219 / 4e-74 AT5G45130 214 / 2e-72 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10036198 [exp] 216 / 2e-72 AT4G19640 216 / 8e-73 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Lus10028820 [exp] 213 / 3e-70 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10017462 [exp] 211 / 3e-67 AT3G54840 349 / 1e-121 Ras-related small GTP-binding family protein (.1.2) Lus10040745 [exp] 149 / 2e-45 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10025432 [exp] 149 / 3e-45 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G117800 [exp] 336 / 3e-119 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.015G113000 [exp] 335 / 1e-118 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 268 / 2e-92 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.003G054900 [exp] 253 / 2e-86 AT4G19640 270 / 4e-93 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Potri.008G035800 [exp] 212 / 3e-70 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.010G226300 [exp] 210 / 1e-69 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.010G197200 [exp] 155 / 1e-47 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.019G092500 [exp] 148 / 6e-45 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.016G000400 [exp] 147 / 1e-44 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 147 / 1e-44 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10018285 pacid=23179369 polypeptide=Lus10018285 locus=Lus10018285.g ID=Lus10018285.BGIv1.0 annot-version=v1.0 ATGGCCGCCACCGGGAACAAGAACATCAACGCTAAGTTGGTCCTCCTTGGCGACCCAGGTGCTGGAAAATCTAGCCTTGTTTTACGATTTGTCAAAGATC AGTTTGTTGAGTTTCAGGAATCAACCATTGGTGCTGCCTTCTTTTCACAAACACTGGCTGTGAATGATGTCACCGTGAAATTTGAGATATGGGACACAGC CGGTCAAGAGAGATATCACAGTCTTGCTCCTATGTACTATCGTGGGGCAGCAGCAGCTATTATTGTGTATGACATTACGAATGCAGCCTCATTTGATCGA GCAAAGAAGTGGGTCCTGGAACTGCAAGCACAAGGCAACCCAAATATGGTCATGGCTCTAGCTGGGAACAAAGCCGATTTGCTTGATGCAAGGAAGGTAG AAGCTGAGGAGGCAGAAGCATACGCAAAGGAGAATGGCCTTTTCTTTATGGAGACCTCAGCGAAAACTGCAACAAACGTCAATGACATTTTCAACGAAAT AGCGAAGAGACTTCCCCGAGTTCAGCCGGCACAGAATCCCACAGGGATGAATCTCAATGATAGACCTGCGGAAAGAGCAGCTAGCGGGACTTGCTGTTCT TAA
AA sequence Show only first row Show all	>Lus10018285 pacid=23179369 polypeptide=Lus10018285 locus=Lus10018285.g ID=Lus10018285.BGIv1.0 annot-version=v1.0 MAATGNKNINAKLVLLGDPGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDVTVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITNAASFDR AKKWVLELQAQGNPNMVMALAGNKADLLDARKVEAEEAEAYAKENGLFFMETSAKTATNVNDIFNEIAKRLPRVQPAQNPTGMNLNDRPAERAASGTCCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10018285 [exp]	0	1
AT1G22540			Major facilitator superfamily ...		Lus10016932 [exp]	7.9	0.8670
AT4G14410	bHLH	bHLH104	basic Helix-Loop-Helix 104, ba...		Lus10021876 [exp]	9.5	0.8305
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Lus10010926 [exp]	20.1	0.8431
AT5G05070			DHHC-type zinc finger family p...		Lus10035395 [exp]	23.1	0.8240
AT1G13740		AFP2	ABI five binding protein 2 (.1...		Lus10004645 [exp]	23.9	0.8022
AT1G01490			Heavy metal transport/detoxifi...		Lus10007911 [exp]	30.2	0.8410
AT4G08500		ARAKIN, ATMEKK1...	MAPK/ERK kinase kinase 1 (.1)		Lus10042698 [exp]	30.7	0.8228
AT3G49870		ATARLA1C	ADP-ribosylation factor-like A...		Lus10019259 [exp]	31.1	0.8383
AT1G70410		ATBCA4	beta carbonic anhydrase 4 (.1....		Lus10030614 [exp]	31.4	0.8488
AT4G39235			unknown protein		Lus10021065 [exp]	39.9	0.8142

Compare expression of checked genes

Lus10018285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.