Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09550 101 / 2e-30 ATGIP1 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1) AT1G73790 100 / 1e-29 Protein of unknown function (DUF3743) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040621 [exp] 115 / 9e-36 AT4G09550 105 / 9e-32 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G035900 [exp] 104 / 2e-31 AT4G09550 100 / 5e-30 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1) Potri.016G034200 [exp] 102 / 1e-30 AT4G09550 102 / 1e-30 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12554 [flax] [poplar] MOZART1 Mitotic-spindle organizing gamma-tubulin ring associated
Representative CDS sequence Show only first row Show all	>Lus10018288 pacid=23179365 polypeptide=Lus10018288 locus=Lus10018288.g ID=Lus10018288.BGIv1.0 annot-version=v1.0 ATGGATAAAGAGGCGGCAAAGACGGCGAGGGAATCGCTGGAGCTGGCGTTCCAGATGTCTAACGTTCTGGAAACGGGTCTCGACCGCCACACTCTCTCCG TGTTGATCGCCCTCTGTGATCTCGGATTGAATCCCGAGGCACTCGCCGCCGTCGTCAAAGAACTTCGGTCCCAAGCTCCGCCTCATCATCCACCGTCGTC TTGA
AA sequence Show only first row Show all	>Lus10018288 pacid=23179365 polypeptide=Lus10018288 locus=Lus10018288.g ID=Lus10018288.BGIv1.0 annot-version=v1.0 MDKEAAKTARESLELAFQMSNVLETGLDRHTLSVLIALCDLGLNPEALAAVVKELRSQAPPHHPPSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09550		ATGIP1	ARABIDOPSIS ATGCP3 INTERACTING...		Lus10018288 [exp]	0	1
AT5G58490			NAD(P)-binding Rossmann-fold s...		Lus10026385 [exp]	15.6	0.6928
					Lus10034887 [exp]	18.3	0.6884
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10020580 [exp]	22.4	0.6989
AT4G36850			PQ-loop repeat family protein ...		Lus10022491 [exp]	23.6	0.6758
AT3G54560		HTA11	histone H2A 11 (.1)		Lus10003088 [exp]	28.7	0.6937
AT1G74340		DPMS2, DPMS	dolichol phosphate mannose syn...		Lus10035381 [exp]	30.6	0.5816
AT4G24320			Ubiquitin carboxyl-terminal hy...		Lus10027445 [exp]	35.0	0.6266
AT2G13690			PRLI-interacting factor, putat...		Lus10033484 [exp]	35.7	0.5942
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10017771 [exp]	36.4	0.6625
AT1G65700			Small nuclear ribonucleoprotei...		Lus10028183 [exp]	42.7	0.6857

Compare expression of checked genes

Lus10018288 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.